BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30523.Seq (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80460.1 68414.m09423 glycerol kinase, putative similar to gl... 54 1e-07 At4g30310.3 68417.m04309 ribitol kinase, putative similar to rib... 35 0.066 At4g30310.2 68417.m04308 ribitol kinase, putative similar to rib... 35 0.066 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 34 0.12 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 34 0.12 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 31 1.1 At4g24900.1 68417.m03564 expressed protein 30 1.9 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 30 1.9 At1g74260.1 68414.m08600 AIR synthase-related family protein con... 29 4.3 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 29 4.3 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 28 5.7 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 28 5.7 At5g27420.1 68418.m03273 zinc finger (C3HC4-type RING finger) fa... 28 5.7 At3g02830.1 68416.m00275 zinc finger (CCCH-type) family protein ... 28 5.7 At2g40070.1 68415.m04923 expressed protein 28 5.7 At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical ... 28 5.7 At5g24480.1 68418.m02885 hypothetical protein similar to unknown... 28 7.6 At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal... 28 7.6 At4g39030.1 68417.m05528 enhanced disease susceptibility 5 (EDS5... 27 10.0 At1g62050.1 68414.m06999 ankyrin repeat protein-related contains... 27 10.0 >At1g80460.1 68414.m09423 glycerol kinase, putative similar to glycerol kinase (ATP:glycerol 3-phosphotransferase, Glycerokinase, GK)[Mycobacterium tuberculosis] Swiss-Prot:O69664 Length = 522 Score = 54.0 bits (124), Expect = 1e-07 Identities = 42/119 (35%), Positives = 59/119 (49%), Gaps = 9/119 (7%) Frame = -3 Query: 731 PAFNGPLFAILGEKDRPGEXCAVLSERTRRQHIVRARAGGR------VSPDARRGGRDGC 570 PAFNG LFA +D G C ++ T + HI RA V + + Sbjct: 357 PAFNG-LFAPWWREDARG-VCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKG 414 Query: 569 RLRAPEATPRRRRDGAELSS---VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402 L + R DG ++ +Q+QADL+G PV+RP+ +E+TALGAA AG A+ W Sbjct: 415 SLNNGKGEFLLRVDGGATANNLLMQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFW 473 >At4g30310.3 68417.m04309 ribitol kinase, putative similar to ribitol kinase [Klebsiella pneumoniae] gi|2905643|gb|AAC26495 Length = 451 Score = 34.7 bits (76), Expect = 0.066 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396 +Q AD++G P+I P ES LGAAI+ A + +P+ Sbjct: 361 IQEHADIVGCPIILPRESESVLLGAAILGAVAGKNYPS 398 >At4g30310.2 68417.m04308 ribitol kinase, putative similar to ribitol kinase [Klebsiella pneumoniae] gi|2905643|gb|AAC26495 Length = 579 Score = 34.7 bits (76), Expect = 0.066 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396 +Q AD++G P+I P ES LGAAI+ A + +P+ Sbjct: 489 IQEHADIVGCPIILPRESESVLLGAAILGAVAGKNYPS 526 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +1 Query: 514 LSSAPSLRRRGVAS---GARSLQPSRPPRRASGDTRPPAR 624 LSS + RR +A+ + S PSRPP+R+ G RPP R Sbjct: 127 LSSMLDIPRRNLATKPGSSPSPSPSRPPKRSRGPPRPPTR 166 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +1 Query: 514 LSSAPSLRRRGVAS---GARSLQPSRPPRRASGDTRPPAR 624 LSS + RR +A+ + S PSRPP+R+ G RPP R Sbjct: 127 LSSMLDIPRRNLATKPGSSPSPSPSRPPKRSRGPPRPPTR 166 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +1 Query: 517 SSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPAR 624 S APS RRR + AR + PP R PPAR Sbjct: 303 SPAPSRRRRSPSPPARRRRSPSPPARRRRSPSPPAR 338 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 523 APSLRRRGVASGARSLQPSRPPRRASGDTRPPARAL 630 +PS+ +R + PS PPRRA + PPA+ L Sbjct: 444 SPSIEQRLPSPPVAQRLPSPPPRRAGLPSPPPAQRL 479 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 520 SAPSLRRRGVASGARSLQPSRPPRRASGDTRPPAR 624 S P+ RRR + AR + PP R PPAR Sbjct: 314 SPPARRRRSPSPPARRRRSPSPPARRHRSPTPPAR 348 Score = 27.5 bits (58), Expect = 10.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 520 SAPSLRRRGVASGARSLQPSRPPRRASGDTRPPAR 624 S P+ RRR + AR + PP R PPAR Sbjct: 324 SPPARRRRSPSPPARRHRSPTPPARQRRSPSPPAR 358 >At4g24900.1 68417.m03564 expressed protein Length = 421 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -2 Query: 510 CADAG*FTGYTSHSSPHDGK-YSPGGGHCRRSRNACVAHDNTQPTGRYIPAG 358 C ++G G+ HS P K YS G +C + N V+ D Q G Y P G Sbjct: 224 CDESG--NGFGEHSIPCRSKDYSGNGNYCTQE-NYQVSQDKKQIDGSYNPPG 272 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 29.9 bits (64), Expect = 1.9 Identities = 23/74 (31%), Positives = 30/74 (40%), Gaps = 1/74 (1%) Frame = +2 Query: 398 WATHALRDLRQWPPPGLYFPS*GDE*LVYPVNQPASAQN*VLRHPSV-GEELPQGRAVCS 574 + TH +D Q PG+ + + V P QP N + S G LPQ S Sbjct: 181 YPTHGYQDFHQQAVPGVSYQQ-HQQFPVPPTTQPERYPNYATGNESFPGVGLPQENLPTS 239 Query: 575 HRVRHGARLVTHGL 616 + RLVTH L Sbjct: 240 SAIHQQERLVTHKL 253 >At1g74260.1 68414.m08600 AIR synthase-related family protein contains Pfam profiles: PF00586 AIR synthase related protein, N-terminal domain, PF02769 AIR synthase related protein, C-terminal domain Length = 1387 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 608 VSPDARRGGRDGCRLRAPEATPRRRRDGAELSSV 507 V+PD + GG DG L A +RR G+ L+ V Sbjct: 898 VTPDLKLGGDDGILLHVDLAKGKRRLGGSALAQV 931 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 28.7 bits (61), Expect = 4.3 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 5/69 (7%) Frame = -1 Query: 388 PAHRPIHSCRLLPMKNEKCGEFVGKKP*INAWDGPILK--MNMST---QKIR*NYCSFAA 224 P P+ S RL PM + CG K+ + W G + K ++ ST Q++ + C + Sbjct: 899 PPFSPLLSPRLPPMVTQLCGSEASKQNIGHQWQGALSKSGVHYSTIIAQRLESDICKYII 958 Query: 223 GTFFPRNRP 197 G+ P P Sbjct: 959 GSPEPVQWP 967 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 28.3 bits (60), Expect = 5.7 Identities = 21/70 (30%), Positives = 28/70 (40%) Frame = +1 Query: 409 RIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPP 588 R A P R RGR + P K A + + RR VAS +R P Sbjct: 207 RGASPVAHKRERTSPDYGRGRRSPSPYKRARLSPDYKR-DDRRRERVASPENGAVRNRSP 265 Query: 589 RRASGDTRPP 618 R+ G++R P Sbjct: 266 RKGRGESRSP 275 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 28.3 bits (60), Expect = 5.7 Identities = 21/70 (30%), Positives = 28/70 (40%) Frame = +1 Query: 409 RIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPP 588 R A P R RGR + P K A + + RR VAS +R P Sbjct: 207 RGASPVAHKRERTSPDYGRGRRSPSPYKRARLSPDYKR-DDRRRERVASPENGAVRNRSP 265 Query: 589 RRASGDTRPP 618 R+ G++R P Sbjct: 266 RKGRGESRSP 275 >At5g27420.1 68418.m03273 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 zinc finger protein ATL6 [Arabidopsis thaliana] gi|4928403|gb|AAD33584.1|AF132016_1[4928403]; contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 368 Score = 28.3 bits (60), Expect = 5.7 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -2 Query: 498 G*FTGYTSH-SSPHDGKYSPGGGHCRRSRNACVAHDNTQPTGRYIPAGSY 352 G FT Y H + DG +P GG RR NA VA T P Y Sbjct: 60 GFFTVYIRHCTGAVDGSVTPAGGARRRVTNATVARGLDAETIETFPTFVY 109 >At3g02830.1 68416.m00275 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 397 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/46 (30%), Positives = 17/46 (36%) Frame = -2 Query: 486 GYTSHSSPHDGKYSPGGGHCRRSRNACVAHDNTQPTGRYIPAGSYQ 349 GY S+ D Y GHC+ H QPT +P Q Sbjct: 127 GYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQ 172 >At2g40070.1 68415.m04923 expressed protein Length = 607 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/62 (29%), Positives = 28/62 (45%) Frame = +1 Query: 415 ARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRR 594 +RPAT+ + A S + S+ LSS+ RR +SG +P+ P R Sbjct: 133 SRPATLTSRLANSSTESAARNHLTSRQQTSSPGLSSSSGASRRPSSSGGPGSRPATPTGR 192 Query: 595 AS 600 +S Sbjct: 193 SS 194 >At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical to DNA polymerase lambda GI:12053869 from [Arabidopsis thaliana] Length = 529 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -2 Query: 552 GNSSPTEGWRRTQFCADAG*FTGYTSHSSPHDGKYSP 442 G+ + +RT++ DAG F G SHS+ SP Sbjct: 128 GSEDQSSPQKRTRYSPDAGDFKGVESHSNTQGSPDSP 164 >At5g24480.1 68418.m02885 hypothetical protein similar to unknown protein (gb|AAD32930.1) Length = 350 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -3 Query: 470 RPLMMESTALGAAIVAGRAMRVWPTTIPSP---PADTFL 363 RP ++ + R R WP T+PSP A TFL Sbjct: 10 RPHFQSIHFFDCSLTSDRGQRSWPATLPSPQPLSASTFL 48 >At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal, putative / glycolate oxidase, putative / short chain alpha-hydroxy acid oxidase, putative similar to Chain A, Glycolate Oxidase (E.C.1.1.3.15) Mutant With Tyr 24 Replaced By Phe (Y24f) gi|999542 Length = 363 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -3 Query: 539 RRRDGAELSSVQMQADLLGIPVIRPLMMESTAL 441 R R ++S++ M +LG P+ P+M+ TA+ Sbjct: 49 RPRVLVDVSNIDMSTSMLGYPISAPIMIAPTAM 81 >At4g39030.1 68417.m05528 enhanced disease susceptibility 5 (EDS5) / salicylic acid induction deficient 1 (SID1) identical to SP|Q945F0; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 543 Score = 27.5 bits (58), Expect = 10.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 442 WGRPLSQVAQCVCGPRQYPAHRPIHSCRLL 353 WG PLSQ AQ Y A+R + R L Sbjct: 371 WGEPLSQTAQSFMPEMLYGANRNLPKARTL 400 >At1g62050.1 68414.m06999 ankyrin repeat protein-related contains weak hit to Pfam profile PF00023: Ankyrin repeat Length = 497 Score = 27.5 bits (58), Expect = 10.0 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 517 SSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPARAL 630 S+AP R+ S RS+ +PPRR+ +PP R++ Sbjct: 252 SAAPPPPRQS-QSPRRSVSQFQPPRRSMAQVQPPRRSV 288 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,338,838 Number of Sequences: 28952 Number of extensions: 364420 Number of successful extensions: 903 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 903 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -