BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30512.Seq (457 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 4.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 5.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 5.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 5.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 5.5 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 7.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.2 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.4 bits (43), Expect = 4.1 Identities = 13/51 (25%), Positives = 21/51 (41%) Frame = +2 Query: 65 KGERKGKSAINXLLPVNIQLIYTNDFMXLDLKSVPQEQSKKSEXSLXNRWE 217 K ++K K I + +L T + + QE+ + SL N WE Sbjct: 260 KEDKKKKKTIKEKYTEDEELNKTKPIWTRNADDISQEEYGEFYKSLTNDWE 310 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.5 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -3 Query: 92 WLICLFFHLWV 60 W+ CL F WV Sbjct: 131 WMWCLIFAFWV 141 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.5 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -3 Query: 92 WLICLFFHLWV 60 W+ CL F WV Sbjct: 131 WMWCLIFAFWV 141 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.5 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -3 Query: 92 WLICLFFHLWV 60 W+ CL F WV Sbjct: 131 WMWCLIFAFWV 141 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.5 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -3 Query: 92 WLICLFFHLWV 60 W+ CL F WV Sbjct: 131 WMWCLIFAFWV 141 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 20.6 bits (41), Expect = 7.2 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 211 MGTPDIRVDTRLNKFFGLRESXMFP 285 MG P ++D++ GL M+P Sbjct: 142 MGIPPYQLDSKTAGSMGLTRPPMYP 166 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 20.6 bits (41), Expect = 7.2 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 211 MGTPDIRVDTRLNKFFGLRESXMFP 285 MG P ++D++ GL M+P Sbjct: 34 MGIPPYQLDSKTAGSMGLTRPPMYP 58 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 7.2 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 453 LMFFCILKEFIL 418 L FFC+ EFI+ Sbjct: 979 LFFFCMAAEFII 990 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 7.2 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 453 LMFFCILKEFIL 418 L FFC+ EFI+ Sbjct: 979 LFFFCMAAEFII 990 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,205 Number of Sequences: 336 Number of extensions: 1672 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10406187 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -