BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30512.Seq (457 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces... 73 2e-14 SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr ... 26 3.1 SPAC17C9.07 |alg8||glucosyltransferase Alg8|Schizosaccharomyces ... 25 4.2 SPAC806.08c |mod21||gamma tubulin complex subunit Mod21|Schizosa... 24 9.6 >SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 73.3 bits (172), Expect = 2e-14 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +1 Query: 103 VTREYTVNLHKRLHGXGFKKRAPRAIKEIRXFAXKQMGTPDIRVDTRLNK 252 VTR+YT+++HKRL+G FKKRAPRAIKEI FA K M T ++RVD LNK Sbjct: 13 VTRDYTIHMHKRLYGVSFKKRAPRAIKEIVAFAQKHMQTKEVRVDPSLNK 62 >SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 25.8 bits (54), Expect = 3.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 430 GVYSWLASTFSVCKPLID 377 GV WLAST+S C +++ Sbjct: 464 GVVCWLASTYSFCDGIVN 481 >SPAC17C9.07 |alg8||glucosyltransferase Alg8|Schizosaccharomyces pombe|chr 1|||Manual Length = 501 Score = 25.4 bits (53), Expect = 4.2 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 457 FPDVFLYTKGVYSWLASTFSVCKPLID 377 +P F Y + V SW+A F K ++D Sbjct: 60 YPPFFAYMECVLSWIAYFFGFDKAMLD 86 >SPAC806.08c |mod21||gamma tubulin complex subunit Mod21|Schizosaccharomyces pombe|chr 1|||Manual Length = 618 Score = 24.2 bits (50), Expect = 9.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 375 QQARKSLV*ITYVRNLHHHYVFVKASH 295 ++A+KSL + R + HYVFV H Sbjct: 452 EEAKKSLWSKRFSRFYYGHYVFVNTCH 478 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,655,770 Number of Sequences: 5004 Number of extensions: 27697 Number of successful extensions: 49 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 170285640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -