BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30507.Seq (748 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 6.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 6.0 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 22 6.0 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 7.9 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 21 7.9 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 21 7.9 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +3 Query: 408 NVPKSNNYVNEQIRGYI-RNSHE 473 N+ KSN NEQ+R Y+ +N E Sbjct: 319 NLEKSNLNHNEQLRKYLCKNEDE 341 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +3 Query: 408 NVPKSNNYVNEQIRGYI-RNSHE 473 N+ KSN NEQ+R Y+ +N E Sbjct: 211 NLEKSNLNHNEQLRKYLCKNEDE 233 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 252 FKCAVCGTKLTLK 290 FKC +CG T K Sbjct: 163 FKCKICGRAFTTK 175 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 376 TTPQWASEALSTCPKAITTSTNRSEDTSGTAMSQNCLRSG 495 T+P S + P TTS N S S T+ + + ++G Sbjct: 144 TSPLSVSTSPPGKPATSTTSQNLSSPASSTSSTSSTEKAG 183 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 465 SHEPELSPIRATNGGASTRLQQGSYRVIPL 554 SHEPE+ + + G R S +++ L Sbjct: 71 SHEPEMERPKGASNGKRARTAYTSSQLVEL 100 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 465 SHEPELSPIRATNGGASTRLQQGSYRVIPL 554 SHEPE+ + + G R S +++ L Sbjct: 91 SHEPEMERPKGASNGKRARTAYTSSQLVEL 120 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,603 Number of Sequences: 336 Number of extensions: 4113 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -