BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30502.Seq (748 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 25 0.64 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 23 2.6 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 23 2.6 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 23 2.6 AM295016-1|CAL25731.1| 96|Tribolium castaneum ecdysone recepto... 21 7.9 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 25.0 bits (52), Expect = 0.64 Identities = 11/45 (24%), Positives = 23/45 (51%) Frame = -3 Query: 659 HKFTICQVLLQVKFNTQCIYYYINLNLNQTQKSSTLHSMRLSVWV 525 H FT+C+ L+ + N + + N+ ++T K S + +W+ Sbjct: 163 HIFTVCRTLIYIDDNVKGLGKQYNIASSKTLKLSINIISLVQLWI 207 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = -1 Query: 355 LLFLHQEPQISSSHQSLSFLWHHRSQMHRCFLRHTIFSRRI 233 + F EP+ S HQ L+ L S + + H + +R+ Sbjct: 116 ITFYRDEPRFSQPHQILTLLMDIDSLITKWRYNHVLMVQRM 156 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = -1 Query: 355 LLFLHQEPQISSSHQSLSFLWHHRSQMHRCFLRHTIFSRRI 233 + F EP+ S HQ L+ L S + + H + +R+ Sbjct: 276 ITFYRDEPRFSQPHQILTLLMDIDSLITKWRYNHVLMVQRM 316 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = -1 Query: 355 LLFLHQEPQISSSHQSLSFLWHHRSQMHRCFLRHTIFSRRI 233 + F EP+ S HQ L+ L S + + H + +R+ Sbjct: 276 ITFYRDEPRFSQPHQILTLLMDIDSLITKWRYNHVLMVQRM 316 >AM295016-1|CAL25731.1| 96|Tribolium castaneum ecdysone receptor (isoform B) protein. Length = 96 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 110 VAPEEVTSTEPKESPVKKSPAKKVEAAE 193 VAPEE +S S + SPA + + + Sbjct: 9 VAPEESSSEVTSSSALVMSPANSLASTD 36 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,868 Number of Sequences: 336 Number of extensions: 3397 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -