BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30498.Seq (518 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 25 0.47 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 25 0.47 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 25 0.47 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.1 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 5.7 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 25.0 bits (52), Expect = 0.47 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +2 Query: 233 WSCSTSLPIRQAISKALIAFYQKYVDEASKKEIKDI 340 WS S P+ +I K ++ +Y KY + K +++ Sbjct: 408 WSTSLRDPVFFSIYKTILDYYHKYKENLPKYTTEEL 443 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 25.0 bits (52), Expect = 0.47 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +2 Query: 233 WSCSTSLPIRQAISKALIAFYQKYVDEASKKEIKDI 340 WS S P+ +I K ++ +Y KY + K +++ Sbjct: 408 WSTSLRDPVFFSIYKTILDYYHKYKENLPKYTTEEL 443 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 25.0 bits (52), Expect = 0.47 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +2 Query: 233 WSCSTSLPIRQAISKALIAFYQKYVDEASKKEIKDI 340 WS S P+ +I K ++ +Y KY + K +++ Sbjct: 34 WSTSLRDPVFFSIYKTILDYYHKYKENLPKYTTEEL 69 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = -1 Query: 242 YMTTTLDCHSDXNHREFFLAEQKD 171 ++TTT+DC + + E + +QK+ Sbjct: 958 HITTTIDCSTQSEYYELEVKDQKN 981 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -1 Query: 131 QVQWAPVYTQHSMTTLAIRNCGGGFLTSE 45 Q+ YTQ+S+ A G G ++ E Sbjct: 1043 QIMNLKTYTQYSVVVQAFNKVGSGPMSEE 1071 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,771 Number of Sequences: 438 Number of extensions: 3154 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14477538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -