BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30483.Seq (667 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2G11.03c |vps45||vacuolar sorting protein Vps 45|Schizosacch... 96 5e-21 SPCC74.01 |sly1||SNARE binding protein Sly1|Schizosaccharomyces ... 41 2e-04 SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 29 0.46 SPBC25H2.09 |||DUF1690 family protein|Schizosaccharomyces pombe|... 26 5.6 SPAC1F3.10c |oct1||mitochondrial intermediate peptidase Oct1 |Sc... 25 9.8 >SPAC2G11.03c |vps45||vacuolar sorting protein Vps 45|Schizosaccharomyces pombe|chr 1|||Manual Length = 558 Score = 95.9 bits (228), Expect = 5e-21 Identities = 41/77 (53%), Positives = 55/77 (71%) Frame = +3 Query: 255 HMKCIVFIRPTSENIALLSRELRDPKYGVYFIYFSNVVSKADIKTLAECDEXEAVREVQE 434 H+KC+ F+RPT + LL ELRDPKY Y +YF+NV+ K+ ++ LAE D+ EAV+ +QE Sbjct: 63 HLKCVAFLRPTPTTLRLLCEELRDPKYAEYHLYFTNVIPKSFLERLAESDDFEAVKSIQE 122 Query: 435 VFADYLAVDRHLFSFNI 485 F DYL V+ L SFNI Sbjct: 123 FFLDYLVVNNDLASFNI 139 Score = 36.7 bits (81), Expect = 0.003 Identities = 16/51 (31%), Positives = 33/51 (64%) Frame = +1 Query: 61 MNVIQAVKMYITKMTXXSGPGMKVILMDKETTSIVSMVYSQSEILQKEVYL 213 M+++ A + Y K +K++L++++TT IVS +QS +L++++YL Sbjct: 1 MDLVSASQSYF-KRIFQEVSDLKILLLEEDTTKIVSSCITQSNLLEQQIYL 50 >SPCC74.01 |sly1||SNARE binding protein Sly1|Schizosaccharomyces pombe|chr 3|||Manual Length = 639 Score = 40.7 bits (91), Expect = 2e-04 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 4/77 (5%) Frame = +3 Query: 267 IVFIRPTSENIALLSRELRDPKYGVYFIYFSNVVSKADIKTLAE----CDEXEAVREVQE 434 I F++PT ENI L+ +L Y ++ FS+ +S+A ++ AE + + +V + Sbjct: 92 IYFVQPTQENIELIIEDLSKGLYESAYVCFSSTISRALLEQFAELASKTNTSHMIHQVYD 151 Query: 435 VFADYLAVDRHLFSFNI 485 + +Y+ ++ FS + Sbjct: 152 QYLNYVVLESDFFSLQL 168 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 29.5 bits (63), Expect = 0.46 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 280 RIKTMHFMCSCYPIWHDCLSSRISKLPSVRFP 185 R++ +H + SC+P HD S + K P FP Sbjct: 430 RLELLHDVLSCFPKKHDSTSRKKPKFPYQYFP 461 >SPBC25H2.09 |||DUF1690 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 162 Score = 25.8 bits (54), Expect = 5.6 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 213 IREDRQSCQMG*HEHMKCIVFIRPTSENIALLSRELRDPKYG 338 IR D C EH + P +E A+L+ +L +PK G Sbjct: 122 IRSDLLKCMS---EHPDKSLICHPLAEKFAILASKLHNPKVG 160 >SPAC1F3.10c |oct1||mitochondrial intermediate peptidase Oct1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 762 Score = 25.0 bits (52), Expect = 9.8 Identities = 21/72 (29%), Positives = 32/72 (44%) Frame = -3 Query: 548 ADLEKLVGDAVGSNPTLEASNNIEREQVSVHSQVVSKNFLDLSDSLXFITFGQSFDVCLR 369 ADL+ + A +E N+ + SV ++++ L L + F SFDV R Sbjct: 321 ADLQLIDKMANAPKHVVEFLENLSLKNSSVLKKILNNLALMKKKELN-LNFLPSFDVWDR 379 Query: 368 NYITEIYKVNTI 333 Y T YK + I Sbjct: 380 EYYTARYKQSLI 391 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,552,423 Number of Sequences: 5004 Number of extensions: 48679 Number of successful extensions: 127 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 303841898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -