BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30477.Seq (696 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles ... 159 6e-41 AJ973471-1|CAJ01518.1| 122|Anopheles gambiae hypothetical prote... 24 5.3 AJ697731-1|CAG26924.1| 122|Anopheles gambiae putative chemosens... 24 5.3 AJ697730-1|CAG26923.1| 122|Anopheles gambiae putative chemosens... 24 5.3 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 9.2 >U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S8 mRNA, complete cds. ). Length = 135 Score = 159 bits (387), Expect = 6e-41 Identities = 75/130 (57%), Positives = 100/130 (76%) Frame = +1 Query: 253 QTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYTLPLGRKKGAKLTEAEE 432 + RIIDVVYNASNNEL+RTKTLVKNAI+V+DA+PFRQWYESHY LPLG+K+ +L EE Sbjct: 4 KARIIDVVYNASNNELIRTKTLVKNAIIVIDASPFRQWYESHYLLPLGKKR--ELKAGEE 61 Query: 433 AIINKKRSQKTARKYLARQRLAKVEVL*KSNSTQGVCWACVASRPGQCGRADGLHLRXAK 612 +++KKR++ RKY+ RQ+ AK++ + G AC++SRPGQ GRADG ++ K Sbjct: 62 DVLSKKRTKSNLRKYVKRQKNAKIDPAVEEQFNAGRLLACISSRPGQVGRADG-YILEGK 120 Query: 613 KLEFYLRXVK 642 +LEFYL+ +K Sbjct: 121 ELEFYLKKIK 130 >AJ973471-1|CAJ01518.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 23.8 bits (49), Expect = 5.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 339 YNNCILDKGLCTHQ 298 Y C+LDKG CT + Sbjct: 44 YLKCLLDKGPCTQE 57 >AJ697731-1|CAG26924.1| 122|Anopheles gambiae putative chemosensory protein CSP2 protein. Length = 122 Score = 23.8 bits (49), Expect = 5.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 339 YNNCILDKGLCTHQ 298 Y C+LDKG CT + Sbjct: 44 YLKCLLDKGPCTQE 57 >AJ697730-1|CAG26923.1| 122|Anopheles gambiae putative chemosensory protein CSP1 protein. Length = 122 Score = 23.8 bits (49), Expect = 5.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 339 YNNCILDKGLCTHQ 298 Y C+LDKG CT + Sbjct: 44 YLKCLLDKGPCTQE 57 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 129 LQTPGSALSESTPFVHVVEILSTV 200 + TP A++ STPF+ +LS + Sbjct: 527 VNTPAGAINMSTPFIDSEIVLSAL 550 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 699,545 Number of Sequences: 2352 Number of extensions: 14959 Number of successful extensions: 32 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -