BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30476.Seq (766 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53416| Best HMM Match : Acetyltransf_1 (HMM E-Value=2.7e-21) 28 9.5 SB_51927| Best HMM Match : Acetyltransf_1 (HMM E-Value=2.7e-21) 28 9.5 >SB_53416| Best HMM Match : Acetyltransf_1 (HMM E-Value=2.7e-21) Length = 209 Score = 27.9 bits (59), Expect = 9.5 Identities = 18/67 (26%), Positives = 35/67 (52%) Frame = +1 Query: 4 PKLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTL 183 P L L LV +V + L L+G+ + AV + L F + + H++E + ++ K Y++ Sbjct: 43 PALFLTRLVAAVTSV-WLALIGLGLIVSAVYISYYLKFMQ-HINHALETDLADISKSYSV 100 Query: 184 NAQNCWI 204 + W+ Sbjct: 101 EKSSFWV 107 >SB_51927| Best HMM Match : Acetyltransf_1 (HMM E-Value=2.7e-21) Length = 238 Score = 27.9 bits (59), Expect = 9.5 Identities = 18/67 (26%), Positives = 35/67 (52%) Frame = +1 Query: 4 PKLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTL 183 P L L LV +V + L L+G+ + AV + L F + + H++E + ++ K Y++ Sbjct: 72 PALFLTRLVAAVTSV-WLALIGLGLIVSAVYISYYLKFMQ-HINHALETDLADISKSYSV 129 Query: 184 NAQNCWI 204 + W+ Sbjct: 130 EKSSFWV 136 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,414,852 Number of Sequences: 59808 Number of extensions: 435058 Number of successful extensions: 1011 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1010 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -