BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30475.Seq (777 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45627| Best HMM Match : AAA (HMM E-Value=0) 101 9e-22 SB_53844| Best HMM Match : SRCR (HMM E-Value=0) 28 9.7 SB_35950| Best HMM Match : SRCR (HMM E-Value=0) 28 9.7 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 101 bits (241), Expect = 9e-22 Identities = 46/59 (77%), Positives = 56/59 (94%) Frame = +2 Query: 80 DDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETV 256 D+L+TAIL+ K RPNRL+VEEAV+DDNSVV +SQAKME+LQLFRGDTVL+KGK+RK+TV Sbjct: 5 DELATAILKNKSRPNRLLVEEAVNDDNSVVTMSQAKMEELQLFRGDTVLIKGKKRKDTV 63 Score = 87.8 bits (208), Expect = 9e-18 Identities = 47/85 (55%), Positives = 56/85 (65%) Frame = +3 Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPI*T*GRRGSTKCCRAMMTSGGCRKQ 689 VRGGMRAVEFKV+ETDPSP+CIVAPDTVIHC+GEP+ S GGCRKQ Sbjct: 108 VRGGMRAVEFKVIETDPSPYCIVAPDTVIHCEGEPVKREEEEESLNEV-GYDDIGGCRKQ 166 Query: 690 LGAKLKEMVGVATAVILSMVXRLFE 764 L A++KE G I+S + L + Sbjct: 167 L-AQIKETHGEVERRIVSQLLTLMD 190 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVV 351 L +G+ + CIVLSDD D+KIRM DVV Sbjct: 53 LIKGKKRKDTVCIVLSDDTISDDKIRMNRVVRMNLRVRLGDVV 95 >SB_53844| Best HMM Match : SRCR (HMM E-Value=0) Length = 415 Score = 27.9 bits (59), Expect = 9.7 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -2 Query: 578 HDAKW*WICFDHFELDGAHAPADLKVSSRWIGR*ASMKYGFKYTSNRLP-VRPSTESSIG 402 H W IC+DH++L AH V+ R +G A +K K T + LP V S +G Sbjct: 255 HAGAWGLICYDHWDLHDAH------VACRQVGL-AGVKAVTKETVDGLPRVHLGNVSCVG 307 Query: 401 S 399 + Sbjct: 308 N 308 >SB_35950| Best HMM Match : SRCR (HMM E-Value=0) Length = 501 Score = 27.9 bits (59), Expect = 9.7 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -2 Query: 578 HDAKW*WICFDHFELDGAHAPADLKVSSRWIGR*ASMKYGFKYTSNRLP-VRPSTESSIG 402 H W IC+DH++L AH V+ R +G A +K K T + LP V S +G Sbjct: 318 HAGAWGLICYDHWDLHDAH------VACRQVGL-AGVKAVTKETVDGLPRVHLGNVSCVG 370 Query: 401 S 399 + Sbjct: 371 N 371 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,235,991 Number of Sequences: 59808 Number of extensions: 542300 Number of successful extensions: 1355 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1354 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -