BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30474.Seq (712 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22H10.02 |||conserved fungal protein|Schizosaccharomyces pom... 27 2.6 SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces... 27 2.6 SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyc... 27 2.6 >SPAC22H10.02 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 158 Score = 27.1 bits (57), Expect = 2.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 485 GIPVIRPLMMESTALGAAIVAGRAMRVW 402 GIP+I P+ L A+ + RA ++W Sbjct: 131 GIPIIDPVTRAPAVLAGAVSSSRAKQMW 158 >SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces pombe|chr 2|||Manual Length = 897 Score = 27.1 bits (57), Expect = 2.6 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 290 WTDTKNEHVNAENQIELLQFCRRDFFSSEPPY 195 W +T+N + N +E+L R+ S P Y Sbjct: 764 WANTENARYSTSNALEILDMLLREKIESAPRY 795 >SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1238 Score = 27.1 bits (57), Expect = 2.6 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +2 Query: 545 GVASGARSLQPSRPPRARVW*HTASSAGLTNMLTFEXFSLKTAQS 679 GVA R P+R + + ++SS G+T L E +S T + Sbjct: 480 GVAVNGRVCYPTRNKHSEISAQSSSSLGVTKSLASEVYSSSTVDT 524 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,767,242 Number of Sequences: 5004 Number of extensions: 57755 Number of successful extensions: 123 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -