BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30472.Seq (774 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 24 1.4 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 24 1.4 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 23 2.4 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 5.5 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 9.6 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 24.2 bits (50), Expect = 1.4 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +3 Query: 522 LHERGVIVYLVSGGFRSLIEPVAERLNIPNYQHLR*STQV 641 LH RGV V G RSL+ R+ + N+Q R S V Sbjct: 299 LHHRGVRGTRVPGIVRSLVLDKLARIVLLNFQEERRSEPV 338 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 24.2 bits (50), Expect = 1.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 15 CSSYFPQSGSFIITLVTFTKDK*Y 86 CS F QSG +I + T T +K Y Sbjct: 181 CSKTFIQSGQLVIHMRTHTGEKPY 204 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 23.4 bits (48), Expect = 2.4 Identities = 19/65 (29%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = -1 Query: 426 SLLQGFLECHIAAHCFRRQSFNLVSFPAELGQFIDAFILYDGRVYIEANAVR---CPEQL 256 SLL L C + HC R SF A ++A G ++ AVR PE Sbjct: 8 SLLITCLICSPSVHCGTRPSFVSDEMIATAASVVNACQTQTGVATVDIEAVRNGQWPETR 67 Query: 255 RTVCW 241 + C+ Sbjct: 68 QLKCY 72 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 533 RSHRISSFGRIQESNRTGR 589 RSHR S R Q SN+ R Sbjct: 70 RSHRFKSLPRCQLSNKRDR 88 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.4 bits (43), Expect = 9.6 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 372 QSFNLVSFPAE-LGQFIDAFIL 310 QS L+SFP E L + + FIL Sbjct: 91 QSITLISFPGELLMRLLKMFIL 112 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,848 Number of Sequences: 438 Number of extensions: 4051 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -