BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30471.Seq (559 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 24 1.0 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 5.4 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 5.4 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 7.2 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 23.8 bits (49), Expect = 1.0 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 159 RFLKFVLQQSGXNQVQWAPVYTQHSMTTLAIR 64 R++K VL +SG + + T+H+ T+ A R Sbjct: 268 RWIKMVLAESGVDTSIYTAHSTRHAATSAAAR 299 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 5.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 258 ISKALIAFYQKYVDEASKKEIKDI 329 I K +IAFY K + + EIK I Sbjct: 126 IVKPIIAFYYKPIKTLNGHEIKFI 149 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 5.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -2 Query: 99 YTQHSMTTLAIRNCGGGXLTSE 34 YTQ+S+ A G G L+ + Sbjct: 1069 YTQYSVVVQAFNKVGAGPLSDD 1090 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +2 Query: 65 RIASVVMECCV*TGAHWT 118 R+ V M+C HWT Sbjct: 179 RLLGVAMDCLKGNAKHWT 196 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,357 Number of Sequences: 336 Number of extensions: 2325 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -