BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30469.Seq (802 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 24 1.6 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 3.7 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 23 3.7 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 8.7 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 8.7 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 170 RFLKFVLQQSGXNQVQWAPVYTQHSMTTLAIR 75 R++K VL +SG + + T+H+ T+ A R Sbjct: 268 RWIKMVLAESGVDTSIYTAHSTRHAATSAAAR 299 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 22.6 bits (46), Expect = 3.7 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 544 FLTFYIFYC 518 FL FY+FYC Sbjct: 14 FLLFYLFYC 22 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.6 bits (46), Expect = 3.7 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 544 FLTFYIFYC 518 FL FY+FYC Sbjct: 14 FLLFYLFYC 22 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 8.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 269 ISKALIAFYQKYVDEASKKEIKDI 340 I K +IAFY K + + EIK I Sbjct: 126 IVKPIIAFYYKPIKTLNGHEIKFI 149 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 50 SEYLDGLDXXTSCLLH 3 S Y+DG+ T C +H Sbjct: 143 SPYMDGVPFVTQCPIH 158 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,260 Number of Sequences: 336 Number of extensions: 3651 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -