BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30466.Seq (747 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25B8.15c |||wybutosine biosynthesis protein Tyw3|Schizosacch... 27 2.1 SPBC11C11.09c |rpl502|rpl5-2, rpl5b|60S ribosomal protein L5|Sch... 25 8.7 SPAC3H5.12c |rpl501|rpl5-1, rpl5|60S ribosomal protein L5|Schizo... 25 8.7 >SPAC25B8.15c |||wybutosine biosynthesis protein Tyw3|Schizosaccharomyces pombe|chr 1|||Manual Length = 237 Score = 27.5 bits (58), Expect = 2.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 323 EXFKSVVPDNKPXGYPFDRPVLP 255 E KS VPD P G+P D P+ P Sbjct: 19 EGLKSSVPDASPKGHP-DSPIFP 40 >SPBC11C11.09c |rpl502|rpl5-2, rpl5b|60S ribosomal protein L5|Schizosaccharomyces pombe|chr 2|||Manual Length = 294 Score = 25.4 bits (53), Expect = 8.7 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = -2 Query: 203 KENYSPIYLTFLTIHQIKRNYNAX-----IRKSKRTLTITVYNSRISCEYV 66 +E + Y I Q K YNA +R S R +T + +SR++ +YV Sbjct: 24 REGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFVTCQIVSSRVNGDYV 74 >SPAC3H5.12c |rpl501|rpl5-1, rpl5|60S ribosomal protein L5|Schizosaccharomyces pombe|chr 1|||Manual Length = 294 Score = 25.4 bits (53), Expect = 8.7 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = -2 Query: 203 KENYSPIYLTFLTIHQIKRNYNAX-----IRKSKRTLTITVYNSRISCEYV 66 +E + Y I Q K YNA +R S R +T + +SR++ +YV Sbjct: 24 REGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFVTCQIVSSRVNGDYV 74 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,162,925 Number of Sequences: 5004 Number of extensions: 34229 Number of successful extensions: 40 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -