BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30463.Seq (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39990.1 68415.m04914 eukaryotic translation initiation facto... 81 8e-16 At5g05780.1 68418.m00636 26S proteasome non-ATPase regulatory su... 74 1e-13 At3g11270.1 68416.m01370 26S proteasome non-ATPase regulatory su... 73 2e-13 At1g10840.1 68414.m01246 eukaryotic translation initiation facto... 49 4e-06 At5g01240.2 68418.m00032 amino acid permease, putative strong si... 30 1.4 At5g01240.1 68418.m00031 amino acid permease, putative strong si... 30 1.4 At2g46280.3 68415.m05757 eukaryotic translation initiation facto... 30 1.9 At2g46280.2 68415.m05756 eukaryotic translation initiation facto... 30 1.9 At2g46280.1 68415.m05755 eukaryotic translation initiation facto... 30 1.9 At5g22940.1 68418.m02682 exostosin family protein contains Pfam ... 28 5.7 At5g67570.1 68418.m08520 pentatricopeptide (PPR) repeat-containi... 28 7.6 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 27 10.0 >At2g39990.1 68415.m04914 eukaryotic translation initiation factor 3 subunit 5 / eIF-3 epsilon / eIF3f (TIF3F1) identical to SP|O04202 Eukaryotic translation initiation factor 3 subunit 5 (eIF-3 epsilon) (eIF3 p32 subunit) (eIF3f) {Arabidopsis thaliana}; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family Length = 293 Score = 81.0 bits (191), Expect = 8e-16 Identities = 34/86 (39%), Positives = 58/86 (67%), Gaps = 1/86 (1%) Frame = +1 Query: 1 ISVKVHPVVLFQIVDAYERRNADSHRVIGTLLGTS-DKGVVEVTNCFCVPHKEHADQVEA 177 ++ ++HP+V+F + D + RR + RVIGTLLG+ G V++ N + VPH E +DQV Sbjct: 26 LTARIHPLVIFNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 85 Query: 178 ELNYAMDVYELNRRVNSSESIVGWWA 255 +++Y ++ + +VNS E+IVGW++ Sbjct: 86 DIDYHHNMLASHLKVNSKETIVGWYS 111 Score = 54.0 bits (124), Expect = 1e-07 Identities = 27/81 (33%), Positives = 43/81 (53%) Frame = +3 Query: 255 TGNEVTNHSSVIHEYYSRECREPVHVTLDTSLAGGRMGLRAYVCVPLGVPNGKQGCMFTP 434 TG V SS+IH++Y+RE P+H+T+DT G ++A+V L + + + F Sbjct: 112 TGAGVNGGSSLIHDFYAREVPNPIHLTVDTGFTNGEGTIKAFVSSNLSLGDRQLVAHFQE 171 Query: 435 VDVTLTCYEPEIVGLQVCQKT 497 + V L + E VG V + T Sbjct: 172 IPVDLRMVDAERVGFDVLKAT 192 >At5g05780.1 68418.m00636 26S proteasome non-ATPase regulatory subunit 7, putative / 26S proteasome regulatory subunit S12, putative / MOV34 protein, putative contains similarity to 26s proteasome regulatory subunit s12 (proteasome subunit p40) (mov34 protein) SP:P26516 from [Mus musculus]; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family Length = 308 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/91 (41%), Positives = 55/91 (60%), Gaps = 4/91 (4%) Frame = +1 Query: 7 VKVHPVVLFQIVDAYERRNADSH-RVIGTLLGTSDKGVVEVTNCFCVPHKEHADQVE--- 174 V VHP+VL IVD Y R DS RV+G LLG+S +GVV+VTN + VP +E Sbjct: 17 VVVHPLVLLSIVDHYNRVAKDSSKRVVGVLLGSSSRGVVDVTNSYAVPFEEDDKDPSIWF 76 Query: 175 AELNYAMDVYELNRRVNSSESIVGWWALAMK 267 + NY ++ + +R+N+ E +VGW++ K Sbjct: 77 LDHNYHESMFHMFKRINAKEHVVGWYSTGPK 107 >At3g11270.1 68416.m01370 26S proteasome non-ATPase regulatory subunit 7, putative / 26S proteasome regulatory subunit S12, putative / MOV34 protein, putative contains similarity to 26S proteasome regulatory subunit S12 (MOV34) SP:P26516 from [Mus musculus] Length = 310 Score = 72.9 bits (171), Expect = 2e-13 Identities = 38/91 (41%), Positives = 54/91 (59%), Gaps = 4/91 (4%) Frame = +1 Query: 7 VKVHPVVLFQIVDAYERRNAD-SHRVIGTLLGTSDKGVVEVTNCFCVPHKEHADQVE--- 174 V VHP+VL IVD Y R D S RV+G LLG+S +G V+VTN + VP +E Sbjct: 17 VIVHPLVLLSIVDHYNRVAKDTSKRVVGVLLGSSSRGTVDVTNSYAVPFEEDDKDTSIWF 76 Query: 175 AELNYAMDVYELNRRVNSSESIVGWWALAMK 267 + NY ++ + +R+N+ E IVGW++ K Sbjct: 77 LDHNYHESMFHMFKRINAKEHIVGWYSTGPK 107 >At1g10840.1 68414.m01246 eukaryotic translation initiation factor 3 subunit 3 / eIF-3 gamma / eIF3h (TIF3H1) identical to SP|Q9C5Z2 Eukaryotic translation initiation factor 3 subunit 3 (eIF-3 gamma) (eIF3 p38 subunit) (eIF3h) {Arabidopsis thaliana}; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family Length = 337 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +1 Query: 79 VIGTLLGTSDKGVVEVTNCFCVPHKEHADQVEAE-LNYAMDVYELNRRVNSSESIVGWW 252 V G LLG V+EVTNCF P ++ +++EA+ NY +++ R VN + VGW+ Sbjct: 47 VTGQLLGLDVGSVLEVTNCFPFPVRDDDEEIEADGANYQLEMMRCLREVNVDNNTVGWY 105 >At5g01240.2 68418.m00032 amino acid permease, putative strong similarity to AUX1 GI:1531758 from [Arabidopsis thaliana]; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 408 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -2 Query: 222 DSSVQLVNIHRVIKFRFDLIGMFFVWHAEAVGYFH 118 D++V L+ IH+ I F F ++FVW +A+G H Sbjct: 238 DTAVILMLIHQFITFGFACTPLYFVWE-KAIGMHH 271 >At5g01240.1 68418.m00031 amino acid permease, putative strong similarity to AUX1 GI:1531758 from [Arabidopsis thaliana]; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 488 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -2 Query: 222 DSSVQLVNIHRVIKFRFDLIGMFFVWHAEAVGYFH 118 D++V L+ IH+ I F F ++FVW +A+G H Sbjct: 318 DTAVILMLIHQFITFGFACTPLYFVWE-KAIGMHH 351 >At2g46280.3 68415.m05757 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 254 Score = 29.9 bits (64), Expect = 1.9 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Frame = +1 Query: 166 QVEAELNYAMDVYELNRRVNSSESIVGWWALAMK*---PTTPLL--YTSIIPVNAVSLSM 330 Q + E+ + D+ L + + S + G K T LL YT+++PVNAVSLS Sbjct: 185 QSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAVSLSP 244 Query: 331 LL 336 LL Sbjct: 245 LL 246 >At2g46280.2 68415.m05756 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 328 Score = 29.9 bits (64), Expect = 1.9 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Frame = +1 Query: 166 QVEAELNYAMDVYELNRRVNSSESIVGWWALAMK*---PTTPLL--YTSIIPVNAVSLSM 330 Q + E+ + D+ L + + S + G K T LL YT+++PVNAVSLS Sbjct: 185 QSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAVSLSP 244 Query: 331 LL 336 LL Sbjct: 245 LL 246 >At2g46280.1 68415.m05755 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 328 Score = 29.9 bits (64), Expect = 1.9 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Frame = +1 Query: 166 QVEAELNYAMDVYELNRRVNSSESIVGWWALAMK*---PTTPLL--YTSIIPVNAVSLSM 330 Q + E+ + D+ L + + S + G K T LL YT+++PVNAVSLS Sbjct: 185 QSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAVSLSP 244 Query: 331 LL 336 LL Sbjct: 245 LL 246 >At5g22940.1 68418.m02682 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 469 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +2 Query: 344 FAGWRSNGFTCI-CLCTIGSAKWKARL 421 FAG+RS + CLC +G A W RL Sbjct: 332 FAGYRSEIVRSVFCLCPLGWAPWSPRL 358 >At5g67570.1 68418.m08520 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 611 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 280 PLLYTSIIPVNAVSLSMLLWTLRWLEVEWVYVHM 381 P+L ++ NA+ L+ + TL+W V WV+V + Sbjct: 335 PVLEPDLVVYNAI-LNACVPTLQWKAVSWVFVEL 367 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 27.5 bits (58), Expect = 10.0 Identities = 24/78 (30%), Positives = 31/78 (39%), Gaps = 3/78 (3%) Frame = -1 Query: 529 HAARPATPPDTVFWHT-CRPTISGS*HVRVTSTGVNMQPCFPFGTPNGTQT--YARKPIR 359 H RP P T H RP + VT T + C P P T + + +P Sbjct: 46 HHRRPPLPATTAGHHRQLRPP-----SIPVT-TNTGHRHCRPPSNPATTNSGHHQLRPPP 99 Query: 358 PPASEVSRVTWTGSRHSR 305 PP +S +T TG H R Sbjct: 100 PPPPPLSAITTTGHHHHR 117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,689,815 Number of Sequences: 28952 Number of extensions: 333285 Number of successful extensions: 840 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -