BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30460.Seq (755 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 2.0 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 3.5 AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 23 3.5 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 23 3.5 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 23 3.5 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 23 3.5 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 6.1 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 494 CWKACSSVLKTMTSASDSL-GNKEGACEKMSVQ 399 CWK C T T S SL G E + + ++ Sbjct: 730 CWKECPKNRPTFTELSKSLEGLLENVAQYLQIE 762 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -2 Query: 631 FLGSYVGGAAQSVSEPTTADTCGWWATV 548 F+ S GG S+ + T CG W + Sbjct: 208 FVLSRAGGLVNSLYQNATRKVCGVWKRI 235 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +1 Query: 61 TDVKVAPNFVFGETNKSED 117 ++ ++P+ VFG+ KSED Sbjct: 201 SEQSLSPDTVFGDDGKSED 219 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 22.6 bits (46), Expect = 3.5 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 158 SNAGTFPAGNFFKKSSDL 105 S GT+P+ N++ +SD+ Sbjct: 12 SQHGTYPSDNYYNYTSDI 29 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 22.6 bits (46), Expect = 3.5 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 158 SNAGTFPAGNFFKKSSDL 105 S GT+P+ N++ +SD+ Sbjct: 12 SQHGTYPSDNYYNYTSDI 29 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 22.6 bits (46), Expect = 3.5 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 158 SNAGTFPAGNFFKKSSDL 105 S GT+P+ N++ +SD+ Sbjct: 12 SQHGTYPSDNYYNYTSDI 29 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -1 Query: 500 STCWKACSSVLKTMTSASDSLGNKEGACEKMSVQYF*G 387 S W+A +VLK T L ++ + EK+++++ G Sbjct: 534 SIAWRAFLAVLKRRTEIYKGLIDRIKSREKLTMKFHDG 571 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,136 Number of Sequences: 336 Number of extensions: 3814 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -