BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30460.Seq (755 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 32 0.017 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 28 0.36 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 27 0.83 AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase ... 26 1.1 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 7.7 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 23 7.7 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 7.7 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 32.3 bits (70), Expect = 0.017 Identities = 18/60 (30%), Positives = 31/60 (51%) Frame = +1 Query: 37 LIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESNAIAYYVA 216 L+ A++ ++ + V + +FLK P +P ADG V++ ES+AI Y+A Sbjct: 19 LLFAKWLKLELNLIELDVLKRDHYKPEFLKLNPQHYIPTLVDADGDVVVWESSAILIYLA 78 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 27.9 bits (59), Expect = 0.36 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +1 Query: 100 TNKSEDFLKKFPAGKVPAFESADGK--VLLTESNAIAYYV 213 + K E +L+K P GKVPA E GK V L ES ++ Y+ Sbjct: 55 SEKPEWYLEKNPLGKVPALE-IPGKEGVTLYESLVLSDYI 93 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 26.6 bits (56), Expect = 0.83 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 249 GSQISSAETFIGNVVSDGIAFS*KHLSIGTFEC 151 GSQ +AE F G + +GI + K + EC Sbjct: 88 GSQTGTAEEFAGRLAKEGIRYQMKGMVADPEEC 120 >AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase protein. Length = 259 Score = 26.2 bits (55), Expect = 1.1 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 492 ARARPDVRSSLINVQRWFLTVAH 560 +RAR S+IN QRW LT AH Sbjct: 47 SRARHFCSGSIIN-QRWILTAAH 68 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.4 bits (48), Expect = 7.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 606 PHRA*ASRRRPTLAAGGRRSGTNAERL 526 P R + PT+A GG +G AE + Sbjct: 250 PRRQMTGKPGPTIATGGASTGDAAEEI 276 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 23.4 bits (48), Expect = 7.7 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = -1 Query: 176 TFPSALSNAGTFPAGNFFKKSSDLLVSPNTKFGATFTSVPEYCAAINAL 30 T P+ ++ P+ S DLL+ T T PEY ++ L Sbjct: 291 TLPNIVNFIAQLPSDELRLSSIDLLLQSLTAENGTLVQDPEYVYRLSQL 339 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.4 bits (48), Expect = 7.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 315 PKRRKQAVVRCQTMMPTARHGLGSQISSAE 226 P+RR+QA + + M R G +SSAE Sbjct: 1158 PRRRRQAQRQARAHMLPDRQQNGRAVSSAE 1187 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 797,347 Number of Sequences: 2352 Number of extensions: 17032 Number of successful extensions: 28 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -