BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30459.Seq (534 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09690.1 68414.m01088 60S ribosomal protein L21 (RPL21C) Simi... 115 2e-26 At1g09590.1 68414.m01076 60S ribosomal protein L21 (RPL21A) Simi... 115 2e-26 At1g57860.1 68414.m06565 60S ribosomal protein L21 similar to 60... 113 5e-26 At1g57660.1 68414.m06543 60S ribosomal protein L21 (RPL21E) simi... 113 5e-26 At1g62330.1 68414.m07033 expressed protein contains Pfam PF03138... 36 0.022 At1g54926.1 68414.m06272 hypothetical protein 31 0.64 At5g05900.1 68418.m00651 UDP-glucoronosyl/UDP-glucosyl transfera... 29 1.9 At4g24350.1 68417.m03494 phosphorylase family protein contains P... 29 1.9 At5g25320.1 68418.m03004 ACT domain-containing protein contains ... 28 3.4 At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase fa... 28 3.4 At2g13150.1 68415.m01450 expressed protein contains a bZIP trans... 28 3.4 At4g30860.1 68417.m04381 SET domain-containing protein low simil... 28 4.5 At1g20020.1 68414.m02507 ferredoxin--NADP(+) reductase, putative... 28 4.5 At5g41220.1 68418.m05009 glutathione S-transferase, putative sim... 27 5.9 At4g31490.1 68417.m04473 coatomer beta subunit, putative / beta-... 27 5.9 At1g04680.1 68414.m00465 pectate lyase family protein similar to... 27 5.9 At5g41240.1 68418.m05011 glutathione S-transferase, putative sim... 27 7.9 At5g05890.1 68418.m00649 UDP-glucoronosyl/UDP-glucosyl transfera... 27 7.9 At1g76990.3 68414.m08966 ACT domain containing protein low simil... 27 7.9 At1g76990.2 68414.m08965 ACT domain containing protein low simil... 27 7.9 At1g76990.1 68414.m08964 ACT domain containing protein low simil... 27 7.9 >At1g09690.1 68414.m01088 60S ribosomal protein L21 (RPL21C) Similar to ribosomal protein L21 (gb|L38826). ESTs gb|AA395597,gb|ATTS5197 come from this gene Length = 164 Score = 115 bits (277), Expect = 2e-26 Identities = 55/111 (49%), Positives = 74/111 (66%), Gaps = 1/111 (0%) Frame = +3 Query: 9 MTNSKGYRXGTRDLFARRFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGK 188 M G R TRDLFAR FR G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+ Sbjct: 1 MPAGHGVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGR 60 Query: 189 TGRVYNVTAHALGVIVNKRVRGGLYRS-ASISVLSMSSTPSADKTSLRESK 338 TGR++NVT A+GV VNK++ + R + V + + A++ LR+ K Sbjct: 61 TGRIWNVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKK 111 Score = 74.1 bits (174), Expect = 5e-14 Identities = 36/76 (47%), Positives = 50/76 (65%) Frame = +2 Query: 254 RIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVS 433 RII KRI++RVEHV+ S+C ++F R K+N+ L AKA G+T++ KRQP PK +V Sbjct: 83 RIIRKRIHVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKGPKPGFMVE 142 Query: 434 GTEKPVLLAPIPYEFV 481 G + PIPY+ V Sbjct: 143 GMTLET-VTPIPYDVV 157 >At1g09590.1 68414.m01076 60S ribosomal protein L21 (RPL21A) Similar to L21 family of ribosomal protein; amino acid sequence is identical to F21M12.8 Length = 164 Score = 115 bits (277), Expect = 2e-26 Identities = 55/111 (49%), Positives = 74/111 (66%), Gaps = 1/111 (0%) Frame = +3 Query: 9 MTNSKGYRXGTRDLFARRFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGK 188 M G R TRDLFAR FR G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+ Sbjct: 1 MPAGHGVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGR 60 Query: 189 TGRVYNVTAHALGVIVNKRVRGGLYRS-ASISVLSMSSTPSADKTSLRESK 338 TGR++NVT A+GV VNK++ + R + V + + A++ LR+ K Sbjct: 61 TGRIWNVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKK 111 Score = 74.1 bits (174), Expect = 5e-14 Identities = 36/76 (47%), Positives = 50/76 (65%) Frame = +2 Query: 254 RIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVS 433 RII KRI++RVEHV+ S+C ++F R K+N+ L AKA G+T++ KRQP PK +V Sbjct: 83 RIIRKRIHVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKGPKPGFMVE 142 Query: 434 GTEKPVLLAPIPYEFV 481 G + PIPY+ V Sbjct: 143 GMTLET-VTPIPYDVV 157 >At1g57860.1 68414.m06565 60S ribosomal protein L21 similar to 60S ribosomal protein L21 GI:3885884 from [Oryza sativa] Length = 164 Score = 113 bits (273), Expect = 5e-26 Identities = 54/111 (48%), Positives = 74/111 (66%), Gaps = 1/111 (0%) Frame = +3 Query: 9 MTNSKGYRXGTRDLFARRFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGK 188 M G R TRDLFAR FR G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+ Sbjct: 1 MPAGHGVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGR 60 Query: 189 TGRVYNVTAHALGVIVNKRVRGGLYRS-ASISVLSMSSTPSADKTSLRESK 338 TGR++NVT A+GV VNK++ + R + V + + A++ LR+ + Sbjct: 61 TGRIWNVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKQ 111 Score = 74.9 bits (176), Expect = 3e-14 Identities = 36/76 (47%), Positives = 51/76 (67%) Frame = +2 Query: 254 RIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVS 433 RII KRI++RVEHV+ S+C ++F R K+N+ L +AKA G+T++ KRQP PK +V Sbjct: 83 RIIRKRIHVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTKRQPKGPKPGFMVE 142 Query: 434 GTEKPVLLAPIPYEFV 481 G + PIPY+ V Sbjct: 143 GMTLET-VTPIPYDVV 157 >At1g57660.1 68414.m06543 60S ribosomal protein L21 (RPL21E) similar to 60S ribosomal protein L21 GB:Q43291 GI:2851508 from [Arabidopsis thaliana] Length = 164 Score = 113 bits (273), Expect = 5e-26 Identities = 54/111 (48%), Positives = 74/111 (66%), Gaps = 1/111 (0%) Frame = +3 Query: 9 MTNSKGYRXGTRDLFARRFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGK 188 M G R TRDLFAR FR G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+ Sbjct: 1 MPAGHGVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGR 60 Query: 189 TGRVYNVTAHALGVIVNKRVRGGLYRS-ASISVLSMSSTPSADKTSLRESK 338 TGR++NVT A+GV VNK++ + R + V + + A++ LR+ + Sbjct: 61 TGRIWNVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKQ 111 Score = 74.9 bits (176), Expect = 3e-14 Identities = 36/76 (47%), Positives = 51/76 (67%) Frame = +2 Query: 254 RIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVS 433 RII KRI++RVEHV+ S+C ++F R K+N+ L +AKA G+T++ KRQP PK +V Sbjct: 83 RIIRKRIHVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTKRQPKGPKPGFMVE 142 Query: 434 GTEKPVLLAPIPYEFV 481 G + PIPY+ V Sbjct: 143 GMTLET-VTPIPYDVV 157 >At1g62330.1 68414.m07033 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; Length = 672 Score = 35.5 bits (78), Expect = 0.022 Identities = 23/65 (35%), Positives = 29/65 (44%) Frame = +3 Query: 159 GMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGGLYRSASISVLSMSSTPSADKTSLRESK 338 G P K Y+G GR+ AHAL NK L+R L+ P AD+ S + S Sbjct: 182 GKPKKTYNGTYGRLLAYAAHALAEGQNKLEPKELWREPKDQALAWK--PCADQRSWKPSD 239 Query: 339 RMRGY 353 GY Sbjct: 240 GKNGY 244 >At1g54926.1 68414.m06272 hypothetical protein Length = 273 Score = 30.7 bits (66), Expect = 0.64 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 227 CDCQQACSRRIIPKRINIRVEHVKHSK 307 CD + C R+ PK +I +H KH K Sbjct: 59 CDLSEGCKNRMTPKAFHIISQHPKHHK 85 >At5g05900.1 68418.m00651 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 450 Score = 29.1 bits (62), Expect = 1.9 Identities = 19/54 (35%), Positives = 23/54 (42%) Frame = -2 Query: 242 LVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHFHVRGERN 81 L N S V + + FVW LLN SDV+ V +H R ERN Sbjct: 346 LTHNGWNSTVESVFEGVPMICMPFVWDQLLNARFVSDVWMVG--LHLEGRIERN 397 >At4g24350.1 68417.m03494 phosphorylase family protein contains Pfam PF01048: Phosphorylase family Length = 336 Score = 29.1 bits (62), Expect = 1.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 134 DVYNVSNFVHFHVRGERNSSM 72 DV+NV VHF + G N+SM Sbjct: 114 DVFNVKGIVHFGIAGNMNNSM 134 >At5g25320.1 68418.m03004 ACT domain-containing protein contains Pfam ACT domain PF01842 Length = 500 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 146 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 238 C +GY+ ++ KDR R+ D C+ D Q Sbjct: 291 CEERGYSIVTVKSKDRRRLMFDTICTLVDMQ 321 >At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase family protein belongs to Pfam:PF03372: Endonuclease/Exonuclease/phosphatase family; contains 3 WD-40 repeats (PF00400);similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase EC 3.1.3.56 (5PTASE) (INPP5B) (SP:P32019) [Homo sapiens] Length = 1305 Score = 28.3 bits (60), Expect = 3.4 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +2 Query: 269 RINIRVEHVKHSKCRQDFLKRVKENERL 352 + ++++EHV S RQ+F + +K NE++ Sbjct: 920 KFHVKIEHVDRSVRRQEFGRIIKTNEKV 947 >At2g13150.1 68415.m01450 expressed protein contains a bZIP transcription factor basic domain signature (PDOC00036) Length = 262 Score = 28.3 bits (60), Expect = 3.4 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +3 Query: 288 SMSSTPSADKTSLRESKRMRGY*RKPRLPARPST*RDSQLPLKLPTSSVELRNPS 452 S +STPS ++ + S P L PS+ R + +PL P++SVE R+ S Sbjct: 4 SDNSTPSRPRSITQPSLAFSSL---PPLSPSPSSSRRNSIPLMNPSASVESRDSS 55 >At4g30860.1 68417.m04381 SET domain-containing protein low similarity to IL-5 promoter REII-region-binding protein [Homo sapiens] GI:12642795; contains Pfam profile PF00856: SET domain Length = 497 Score = 27.9 bits (59), Expect = 4.5 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +2 Query: 188 DRSRVQR-DC-SCSR-CDCQQACSRRIIPKRINIRVEHVKH 301 DRS V R C SCS+ C C ++C R K I++ +H Sbjct: 295 DRSCVCRVQCISCSKGCSCPESCGNRPFRKEKKIKIVKTEH 335 >At1g20020.1 68414.m02507 ferredoxin--NADP(+) reductase, putative / adrenodoxin reductase, putative strong similarity to Ferredoxin--NADP reductase, chloroplast precursor (EC 1.18.1.2) (FNR) from {Pisum sativum} SP|P10933, {Mesembryanthemum crystallinum} SP|P41343, {Spinacia oleracea} SP|P00455, [Capsicum annuum] GI:6899972 Length = 369 Score = 27.9 bits (59), Expect = 4.5 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 108 YKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 239 Y+ G V + +G + G PHKV R+Y++ + ALG + N Sbjct: 125 YREGQSVGVIADGIDKNGKPHKV------RLYSIASSALGDLGN 162 >At5g41220.1 68418.m05009 glutathione S-transferase, putative similar to emb|CAA10662 Length = 590 Score = 27.5 bits (58), Expect = 5.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 68 HTWNYSALHVHESVQSWRHCRHQRQWCS 151 +T NY + E +WR RH ++WCS Sbjct: 370 YTNNYKSNFTLE--HAWRELRHSKKWCS 395 >At4g31490.1 68417.m04473 coatomer beta subunit, putative / beta-coat protein, putative / beta-COP, putative similar to Coatomer beta subunit (Beta-coat protein) (Beta-COP) from {Rattus norvegicus} SP|P23514, {Mus musculus} SP|Q9JIF7, {Homo sapiens} SP|P53618; contains Pfam profile: PF01602 Adaptin N terminal region Length = 948 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/39 (30%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +2 Query: 275 NIRVEHVKHSKCRQDFLKRVKENE-RLLKEAKAAGKTVN 388 N+ ++ + CRQ F+K + E + R ++E KA +T + Sbjct: 628 NVEMKKIWLESCRQSFVKMISEKQLREMEELKAKTQTTH 666 >At1g04680.1 68414.m00465 pectate lyase family protein similar to pectate lyase GP:14531296 from [Fragaria x ananassa] Length = 431 Score = 27.5 bits (58), Expect = 5.9 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -2 Query: 185 SMVYFVWHTLLNCTIASDVYNVSNFVHFHVRGERNS-SMCAEPASEQVPGAAAVTLGVRH 9 S +F W T+ +D +S F HV + NS S CA+ + V G+ A+T+ H Sbjct: 216 SETHFGWRTM------ADGDAISIFGSSHVWIDHNSLSHCADGLVDAVMGSTAITISNNH 269 Query: 8 L 6 L Sbjct: 270 L 270 >At5g41240.1 68418.m05011 glutathione S-transferase, putative similar to glutathione S-transferase, GST 10b GB:CAA10662 [Arabidopsis thaliana] 37349. Length = 591 Score = 27.1 bits (57), Expect = 7.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 113 SWRHCRHQRQWCSS 154 +WR RH ++WCS+ Sbjct: 385 AWRELRHNKKWCST 398 >At5g05890.1 68418.m00649 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 455 Score = 27.1 bits (57), Expect = 7.9 Identities = 22/80 (27%), Positives = 31/80 (38%) Frame = -2 Query: 242 LVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHFHVRGERNSSMCAE 63 L N S V A + + F W +LN SDV+ V ++ R ERN A Sbjct: 351 LTHNGWSSTVESVCEAVPMICLPFRWDQMLNARFVSDVWMVG--INLEDRVERNEIEGAI 408 Query: 62 PASEQVPGAAAVTLGVRHLR 3 P A+ + HL+ Sbjct: 409 RRLLVEPEGEAIRERIEHLK 428 >At1g76990.3 68414.m08966 ACT domain containing protein low similarity to uridylyltransferase SP|P56884 from Rhizobium meliloti; contains Pfam ACT domain PF01842 Length = 453 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 146 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 238 C KGY+ ++ +DR ++ D C+ D Q Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289 >At1g76990.2 68414.m08965 ACT domain containing protein low similarity to uridylyltransferase SP|P56884 from Rhizobium meliloti; contains Pfam ACT domain PF01842 Length = 453 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 146 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 238 C KGY+ ++ +DR ++ D C+ D Q Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289 >At1g76990.1 68414.m08964 ACT domain containing protein low similarity to uridylyltransferase SP|P56884 from Rhizobium meliloti; contains Pfam ACT domain PF01842 Length = 453 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 146 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 238 C KGY+ ++ +DR ++ D C+ D Q Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,014,293 Number of Sequences: 28952 Number of extensions: 225525 Number of successful extensions: 755 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -