BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30457.Seq (757 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC5D6.07c |||PXA domain protein|Schizosaccharomyces pombe|chr ... 32 0.077 SPBPB10D8.02c |||arylsulfatase |Schizosaccharomyces pombe|chr 2|... 31 0.23 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 29 0.72 SPBC1271.10c |||membrane transporter|Schizosaccharomyces pombe|c... 27 2.2 SPAC3A12.17c |cys12|cys1b|cysteine synthase Cys12|Schizosaccharo... 26 5.0 SPCC1235.01 ||SPCC320.02c|sequence orphan|Schizosaccharomyces po... 26 5.0 SPBC11C11.09c |rpl502|rpl5-2, rpl5b|60S ribosomal protein L5|Sch... 26 5.0 SPAC3H5.12c |rpl501|rpl5-1, rpl5|60S ribosomal protein L5|Schizo... 26 5.0 SPAC25B8.15c |||wybutosine biosynthesis protein Tyw3|Schizosacch... 26 5.0 >SPAC5D6.07c |||PXA domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 495 Score = 32.3 bits (70), Expect = 0.077 Identities = 22/63 (34%), Positives = 27/63 (42%) Frame = -1 Query: 628 GFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKKTLYRWPKSTSSWTKERFL 449 G P+ W FY L F QK N S +TR + FF LY W S++ E Sbjct: 205 GVPY-FSTAWFQFY-LKLFSQKDNVSSSDLTR----WFFFYTLLYPWIALVSAFVAETMT 258 Query: 448 LTC 440 L C Sbjct: 259 LCC 261 >SPBPB10D8.02c |||arylsulfatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 554 Score = 30.7 bits (66), Expect = 0.23 Identities = 17/57 (29%), Positives = 25/57 (43%) Frame = -1 Query: 655 FLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKKTLYRWP 485 FL P Y N P + NFY ++F +K+ +S + FA+ T WP Sbjct: 167 FLPPLYTHNHDPVD-HKSLKNFYSSNYFAEKLIDQLKNREKSQSFFAYLPFTAPHWP 222 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 29.1 bits (62), Expect = 0.72 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 362 VFVYPYEPTPKESEPFKSVVPDNKPFGYP 276 + VY + P +SE F +VV DN YP Sbjct: 4194 ILVYQHLPDSSQSETFLNVVTDNSAVDYP 4222 >SPBC1271.10c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 581 Score = 27.5 bits (58), Expect = 2.2 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = -1 Query: 664 VKMFLGPKYDENGFPFSLEDNWMNFY----ELDWFVQKVNPGQSQI 539 +++FL P +G + +D W++FY E DW N G + + Sbjct: 338 LRIFLFPAVLYSGLQWGAQDAWLSFYLTTEEEDWMEAPYNYGDNAV 383 >SPAC3A12.17c |cys12|cys1b|cysteine synthase Cys12|Schizosaccharomyces pombe|chr 1|||Manual Length = 395 Score = 26.2 bits (55), Expect = 5.0 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Frame = +3 Query: 360 YKQLEGESIVCTLRQHQPRRHSVR------GVEHVSRNLSLVQELVDFGHR 494 +K L G R+ RRH V G+ ++RN S+ + L+D +R Sbjct: 261 HKVLHGVMFDLAEREGTRRRHQVDTIVEGVGINRMTRNFSIAEPLIDMAYR 311 >SPCC1235.01 ||SPCC320.02c|sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 658 Score = 26.2 bits (55), Expect = 5.0 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = +1 Query: 274 NG*PNGLLSGTTDLNGSDSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELNMSVG 453 +G + L + + N +++ G+Y N NS N + S SL+G+ S LN S G Sbjct: 550 SGMASSFLGSSGNNNNNNNSNSGNYN--NNNSGNNNQQHQQSSS-SLQGLASSFLNSSSG 606 >SPBC11C11.09c |rpl502|rpl5-2, rpl5b|60S ribosomal protein L5|Schizosaccharomyces pombe|chr 2|||Manual Length = 294 Score = 26.2 bits (55), Expect = 5.0 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = -3 Query: 203 KENYSPIYLTFLTIHQIKRNYNA-----LIRKSKRTLTITVYNSRISCEYV 66 +E + Y I Q K YNA ++R S R +T + +SR++ +YV Sbjct: 24 REGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFVTCQIVSSRVNGDYV 74 >SPAC3H5.12c |rpl501|rpl5-1, rpl5|60S ribosomal protein L5|Schizosaccharomyces pombe|chr 1|||Manual Length = 294 Score = 26.2 bits (55), Expect = 5.0 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = -3 Query: 203 KENYSPIYLTFLTIHQIKRNYNA-----LIRKSKRTLTITVYNSRISCEYV 66 +E + Y I Q K YNA ++R S R +T + +SR++ +YV Sbjct: 24 REGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFVTCQIVSSRVNGDYV 74 >SPAC25B8.15c |||wybutosine biosynthesis protein Tyw3|Schizosaccharomyces pombe|chr 1|||Manual Length = 237 Score = 26.2 bits (55), Expect = 5.0 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 323 EPFKSVVPDNKPFGYPFDRPVLP 255 E KS VPD P G+P D P+ P Sbjct: 19 EGLKSSVPDASPKGHP-DSPIFP 40 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,730,365 Number of Sequences: 5004 Number of extensions: 57205 Number of successful extensions: 164 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -