BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30457.Seq (757 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 31 0.76 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_37793| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) 29 4.1 SB_28426| Best HMM Match : Sushi (HMM E-Value=7) 29 4.1 SB_27357| Best HMM Match : MFMR (HMM E-Value=3.2) 29 5.4 SB_1509| Best HMM Match : SRR (HMM E-Value=0.22) 29 5.4 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 31.5 bits (68), Expect = 0.76 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = -1 Query: 673 NAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTD 521 N V ++ PK ++ P S+ D WM+ +E FV+K+N S TD Sbjct: 248 NESVLVWRAPKSSQDALPVSITDRWMSQHE---FVEKLNMQAVLCASSHTD 295 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -3 Query: 419 PSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYP 276 PS ++ P+ Y G+PFQ YP P P F + P + P YP Sbjct: 169 PSPVLSPQ-VYRGYPFQ-----YPGTPPPPMYPAFPPIFPSSPPPEYP 210 >SB_37793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 29.1 bits (62), Expect = 4.1 Identities = 20/73 (27%), Positives = 29/73 (39%), Gaps = 6/73 (8%) Frame = -1 Query: 631 NGFPFSLEDNWMNFYELDWFVQKV-----NPGQSQITRSSTDFAFFKKTLYRWP-KSTSS 470 N +ED YE DW+V KV G++ +T S + +RWP + Sbjct: 598 NELALKVEDFVAAAYEGDWYVGKVQQIDQEDGEALVTFMSRSGTTLQSFSFRWPAREDVI 657 Query: 469 WTKERFLLTCSTP 431 W K +L P Sbjct: 658 WIKRDMILCVIEP 670 >SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) Length = 896 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = -3 Query: 350 PYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPSTSNNLTCSSRRSWSTMKENYSP 186 P PTP+ S P + P +KP +P P + + R ST +N P Sbjct: 130 PQHPTPQHSPPIRKQTPPSKP--HPSPTPAQAPPHSRPVAAKRPMPSTPDQNPCP 182 >SB_28426| Best HMM Match : Sushi (HMM E-Value=7) Length = 181 Score = 29.1 bits (62), Expect = 4.1 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 7/70 (10%) Frame = -3 Query: 263 VLPSTSNN-LTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKR----TLTIT 99 VLP N +TC SRR ++T S +YL LT+ + YN + R LT+ Sbjct: 41 VLPGLYNTRVTCGSRR-YNTRVTCGSRVYLVLLTV--LPGLYNTRVTCDSRMYLVLLTVL 97 Query: 98 --VYNSRISC 75 +YN+R++C Sbjct: 98 PGLYNTRVTC 107 >SB_27357| Best HMM Match : MFMR (HMM E-Value=3.2) Length = 468 Score = 28.7 bits (61), Expect = 5.4 Identities = 22/73 (30%), Positives = 38/73 (52%) Frame = -3 Query: 263 VLPSTSNNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNSR 84 VL + S N + SR ++ T+ +NYS + +LT + +NY+ L SK LT++ Sbjct: 12 VLNTLSKNYSTLSR-NYLTLSKNYSTLSKNYLT---LSKNYSTL---SKNYLTLSKNYLT 64 Query: 83 ISCEYVKTVANVI 45 +S Y+ N + Sbjct: 65 LSKNYLTLSKNYL 77 Score = 28.3 bits (60), Expect = 7.1 Identities = 20/68 (29%), Positives = 34/68 (50%) Frame = -3 Query: 248 SNNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNSRISCEY 69 S N S + +T+ +NYS + +LT + +NY+ L SK LT++ S +S Y Sbjct: 2 SKNYLTLSIKVLNTLSKNYSTLSRNYLT---LSKNYSTL---SKNYLTLSKNYSTLSKNY 55 Query: 68 VKTVANVI 45 + N + Sbjct: 56 LTLSKNYL 63 >SB_1509| Best HMM Match : SRR (HMM E-Value=0.22) Length = 644 Score = 28.7 bits (61), Expect = 5.4 Identities = 22/73 (30%), Positives = 38/73 (52%) Frame = -3 Query: 263 VLPSTSNNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNSR 84 VL + S N + SR ++ T+ +NYS + +LT + +NY+ L SK LT++ Sbjct: 12 VLNTLSKNYSTLSR-NYLTLSKNYSTLSKNYLT---LSKNYSTL---SKNYLTLSKNYLT 64 Query: 83 ISCEYVKTVANVI 45 +S Y+ N + Sbjct: 65 LSKNYLTLSKNYL 77 Score = 28.3 bits (60), Expect = 7.1 Identities = 20/68 (29%), Positives = 34/68 (50%) Frame = -3 Query: 248 SNNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNSRISCEY 69 S N S + +T+ +NYS + +LT + +NY+ L SK LT++ S +S Y Sbjct: 2 SKNYLTLSIKVLNTLSKNYSTLSRNYLT---LSKNYSTL---SKNYLTLSKNYSTLSKNY 55 Query: 68 VKTVANVI 45 + N + Sbjct: 56 LTLSKNYL 63 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,198,595 Number of Sequences: 59808 Number of extensions: 414419 Number of successful extensions: 1024 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1020 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -