BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30456.Seq (478 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 2.5 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 4.4 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 5.8 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 7.7 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 7.7 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 7.7 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 2.5 Identities = 15/60 (25%), Positives = 29/60 (48%) Frame = -2 Query: 447 NYIYSFSWERRRAAAFVTLMLSCWALSTNQLPLLRRDTMSDLCAVLPVLHHQDFQLFNIV 268 N+ + F ++ FVT L CW+ S ++ +L+ S C ++ +FQ+F + Sbjct: 528 NFCFGFITKQLIFMIFVTYQLYCWS-SFLKISVLQSLWASPTCDLM-----YEFQIFTFL 581 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.4 bits (43), Expect = 4.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 331 HGVSSKKRKLIRGKSPAAQHQSDECGRSPP 420 +G SS KRK + + P + + SPP Sbjct: 203 NGKSSAKRKQLVSEHPDSPNSKKSATPSPP 232 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.0 bits (42), Expect = 5.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 110 RYDKLKRNWRKPRGIDNR 163 +++ L +W PRG D+R Sbjct: 631 QFNGLDVDWEYPRGADDR 648 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 20.6 bits (41), Expect = 7.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 196 HQVLTLEPPADSVVNTSRFTPI 131 HQ+LTL DS++ R+ + Sbjct: 129 HQILTLLMDIDSLITKWRYNHV 150 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 20.6 bits (41), Expect = 7.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 196 HQVLTLEPPADSVVNTSRFTPI 131 HQ+LTL DS++ R+ + Sbjct: 289 HQILTLLMDIDSLITKWRYNHV 310 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 20.6 bits (41), Expect = 7.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 196 HQVLTLEPPADSVVNTSRFTPI 131 HQ+LTL DS++ R+ + Sbjct: 289 HQILTLLMDIDSLITKWRYNHV 310 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,030 Number of Sequences: 336 Number of extensions: 2074 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11141978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -