BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30453.Seq (788 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 27 0.87 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 3.5 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 8.1 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 26.6 bits (56), Expect = 0.87 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 319 RQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPP 420 R++ +R +E +L EA A + N + QP PP Sbjct: 1101 REEDERRTEERRQLHNEANRAYRQRNRRSQPTPP 1134 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 24.6 bits (51), Expect = 3.5 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +1 Query: 304 KHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGT 447 KH C + +E +++ KEA +T+NL + +A + GT Sbjct: 323 KHRLCELNREPTEREEQQMQKEAAVMARTMNLNQVCLCFRAYRVEPGT 370 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 8.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 159 TAPLPLMSTMSPTLYTFMYVE 97 TA +P S + PTL+ MY E Sbjct: 607 TAGVPQGSVLGPTLWNLMYNE 627 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 780,486 Number of Sequences: 2352 Number of extensions: 15888 Number of successful extensions: 35 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -