Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30443.Seq
         (608 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF117750-1|AAD38336.1|  380|Anopheles gambiae serine protease 18...    24   3.3  

>AF117750-1|AAD38336.1|  380|Anopheles gambiae serine protease 18D
           protein.
          Length = 380

 Score = 24.2 bits (50), Expect = 3.3
 Identities = 15/61 (24%), Positives = 28/61 (45%)
 Frame = +3

Query: 177 ASLCLPNKQRRLPRPKKWTLMLPVRSLR*GGAETLQQFWDKVLEDIQKVNSEDFKTQALP 356
           A +C P  Q+    P  +++  P+ S   GG+E +    +K   + + + +E     AL 
Sbjct: 57  AIVCCPQSQQLDSPPSGFSIPTPLNSQSRGGSERIS---EKKCNEYKDLTTESVAISALT 113

Query: 357 L 359
           L
Sbjct: 114 L 114


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 563,367
Number of Sequences: 2352
Number of extensions: 10287
Number of successful extensions: 19
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 59291487
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)