BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30436.Seq (887 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 24 1.4 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 24.2 bits (50), Expect = 1.4 Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Frame = +3 Query: 615 PFLDGHGDNMLEPSTKMLGFKGIGRLERKGRAKLTEN-ASLKLSMPSCQLAAPXTSPGLS 791 P D H + P+ + LGF GRL + +E A L+ + A P ++ Sbjct: 195 PLTDDHDEKYGVPTLEELGFDTEGRLPPVWQGGESEALARLERHLERKAWVASFGRPKMT 254 Query: 792 LQDRIPNSVGI 824 Q +P+ G+ Sbjct: 255 PQSLLPSQTGL 265 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,902 Number of Sequences: 336 Number of extensions: 5182 Number of successful extensions: 9 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24617054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -