BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30435.Seq (886 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC776.01 |rpl29||60S ribosomal protein L29|Schizosaccharomyces... 60 3e-10 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 26 8.2 >SPBC776.01 |rpl29||60S ribosomal protein L29|Schizosaccharomyces pombe|chr 2|||Manual Length = 61 Score = 60.5 bits (140), Expect = 3e-10 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHE 254 MAKSKNHTNHNQN+KAHRNGIK+P+K R++ Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPQKHRYD 30 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 25.8 bits (54), Expect = 8.2 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +3 Query: 519 WENPGVTQLNRLAAHPPFASWXIAKRPAPXALPNSCAP 632 W N + L+ AA PP + K P A P S P Sbjct: 1868 WVNDDGSDLSNQAAPPPPPPMALPKAGPPSAAPTSALP 1905 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,250,677 Number of Sequences: 5004 Number of extensions: 59968 Number of successful extensions: 114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 444486180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -