BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30435.Seq (886 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) simi... 60 3e-09 At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) simi... 59 3e-09 At1g80210.1 68414.m09387 expressed protein 29 3.1 At1g27020.1 68414.m03294 expressed protein 28 9.5 >At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) similar to 60S ribosomal protein L29 GB:P25886 from (Rattus norvegicus) Length = 83 Score = 59.7 bits (138), Expect = 3e-09 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +3 Query: 162 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARR 308 +MAKSKNHT HNQ+ KAH+NGIKKPR+ RH P F + +AR+ Sbjct: 22 EMAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARK 70 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 257 TLGMDPKFLRNQRFCKKGNLK 319 T GMDPKFLRNQR+ +K N+K Sbjct: 54 TRGMDPKFLRNQRYARKHNVK 74 >At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) similar to ribosomal protein L29 GI:7959366 [Panax ginseng] Length = 61 Score = 59.3 bits (137), Expect = 3e-09 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = +3 Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARR 308 MAKSKNHT HNQ+ KAH+NGIKKPR+ RH P F + +AR+ Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARK 48 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 257 TLGMDPKFLRNQRFCKKGNLK 319 T GMDPKFLRNQR+ +K N+K Sbjct: 32 TRGMDPKFLRNQRYARKHNVK 52 >At1g80210.1 68414.m09387 expressed protein Length = 354 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = -1 Query: 580 QLAKGGCAARRLSWVTPGFSQSRRVKRRPVNCNTTHYRANWVPGPPSSFXXFXLVFMR 407 + +K G +A + W S+S R K R + N +Y +W+ PSS+ ++R Sbjct: 30 EYSKDGGSATAMIWGASPQSRSDRQKDRNDDINGQNYTGHWMVPLPSSYYRSSFPYVR 87 >At1g27020.1 68414.m03294 expressed protein Length = 308 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 519 WENPGVTQLNRLAAHPPFASWXI 587 WE P T N+LA FA+W + Sbjct: 163 WEKPTSTDFNQLAKESEFAAWTL 185 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,417,354 Number of Sequences: 28952 Number of extensions: 333618 Number of successful extensions: 753 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2071520424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -