BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30434.Seq (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein ... 23 9.0 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 23 9.0 >CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein protein. Length = 196 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -1 Query: 602 EXXXCCHLKVFYEYKXXTIKCFSMKYRGVGSAG 504 E C K Y Y T +C+ M RG +G Sbjct: 82 ENDWVCDCKPTYVYHPETQQCYQMYTRGYCPSG 114 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = +2 Query: 362 HIIRLE---HTYI*QTYLYDYNILQALCIPCIFL 454 H++ LE + + + L DY+I A+ +P IF+ Sbjct: 164 HVLHLEEELYWFHTRVSLVDYSIFTAIMLPTIFM 197 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 546,436 Number of Sequences: 2352 Number of extensions: 8892 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -