BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30433.Seq (904 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10137| Best HMM Match : No HMM Matches (HMM E-Value=.) 124 7e-29 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 119 3e-27 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 118 9e-27 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 118 9e-27 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 118 9e-27 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 118 9e-27 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 118 9e-27 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 118 9e-27 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 118 9e-27 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 118 9e-27 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 118 9e-27 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 118 9e-27 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 118 9e-27 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 118 9e-27 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 118 9e-27 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 118 9e-27 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 118 9e-27 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 118 9e-27 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 118 9e-27 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 118 9e-27 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 118 9e-27 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 118 9e-27 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) 118 9e-27 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 118 9e-27 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) 118 9e-27 SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 118 9e-27 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 118 9e-27 SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 118 9e-27 SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) 118 9e-27 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) 118 9e-27 SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) 118 9e-27 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 118 9e-27 SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 118 9e-27 SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_49504| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) 118 9e-27 SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7) 118 9e-27 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 118 9e-27 SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) 118 9e-27 SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5) 118 9e-27 SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 118 9e-27 SB_46342| Best HMM Match : Secretin_N_2 (HMM E-Value=6.7) 118 9e-27 SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 118 9e-27 SB_45832| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_44667| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_44607| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_43889| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_43888| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_43792| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_43429| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_43017| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) 118 9e-27 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_42668| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_42658| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_42652| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_42572| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_42400| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_42250| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_41999| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_41852| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_41807| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_41675| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_41363| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_41117| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_40365| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_40340| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_40206| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_40029| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_39985| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_39620| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_38461| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=6.5) 118 9e-27 SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_38197| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_37090| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_36577| Best HMM Match : CC (HMM E-Value=7.9) 118 9e-27 SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35411| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35083| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_34588| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_34053| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_34052| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_33852| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) 118 9e-27 SB_33774| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_33771| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_33605| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_33361| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_33192| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_33060| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_32479| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_32421| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_32220| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63) 118 9e-27 SB_31938| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_31587| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_31495| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_30975| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_30661| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_30447| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_30018| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_29984| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_29560| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_29205| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_29171| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_28658| Best HMM Match : I-set (HMM E-Value=1.5) 118 9e-27 SB_28613| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_28406| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_28253| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_28215| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_28209| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_27485| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_26864| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_26690| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_26211| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_26011| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 118 9e-27 SB_25260| Best HMM Match : PqiA (HMM E-Value=0.3) 118 9e-27 SB_25256| Best HMM Match : G-patch (HMM E-Value=3.7) 118 9e-27 SB_25128| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5) 118 9e-27 SB_24116| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_23634| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_22975| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_22925| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_22609| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_21773| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_21563| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_21182| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_20892| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) 118 9e-27 SB_20728| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_20345| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_20175| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_20124| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_19991| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_19473| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_19471| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_19304| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_19023| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 118 9e-27 SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_18273| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_18058| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_18032| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_17618| Best HMM Match : Bombolitin (HMM E-Value=2.1e-07) 118 9e-27 SB_17401| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_17365| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) 118 9e-27 SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_16801| Best HMM Match : MSSP (HMM E-Value=0.31) 118 9e-27 SB_16735| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_16611| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_16600| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_16365| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_16176| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_16128| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_16003| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_15793| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_15304| Best HMM Match : Herpes_UL49_5 (HMM E-Value=1.3) 118 9e-27 SB_15133| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_14400| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_14226| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_14098| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 118 9e-27 SB_13829| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_13824| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_13618| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_13406| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_13252| Best HMM Match : Ligase_CoA (HMM E-Value=9.1) 118 9e-27 SB_13028| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_13007| Best HMM Match : DUF1566 (HMM E-Value=6.2) 118 9e-27 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_12650| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_12577| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_12301| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_12180| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_11368| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_10991| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_10030| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_9824| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_9727| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_9660| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_9352| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_9104| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_8880| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_8518| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_8428| Best HMM Match : Glyco_hydro_2 (HMM E-Value=0.3) 118 9e-27 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) 118 9e-27 SB_7695| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_7685| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_7672| Best HMM Match : 7tm_1 (HMM E-Value=0.48) 118 9e-27 SB_7569| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_7353| Best HMM Match : CAT (HMM E-Value=7.9e-08) 118 9e-27 SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_7229| Best HMM Match : Neurokinin_B (HMM E-Value=7.9) 118 9e-27 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_7001| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_6806| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_6786| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_6663| Best HMM Match : DUF1502 (HMM E-Value=5.7) 118 9e-27 SB_6528| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) 118 9e-27 SB_6371| Best HMM Match : PSI_PsaJ (HMM E-Value=2.6) 118 9e-27 SB_6347| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_6048| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_6044| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_5656| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_5636| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_5557| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_4841| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_4621| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_4076| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_3794| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_3653| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_3553| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_2967| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_2650| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_2273| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_2151| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_1896| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_1855| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_1570| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_1516| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_1381| Best HMM Match : TP2 (HMM E-Value=5.2) 118 9e-27 SB_1240| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_960| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_950| Best HMM Match : Flp_N (HMM E-Value=1.7) 118 9e-27 SB_861| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 >SB_10137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 124 bits (300), Expect = 7e-29 Identities = 53/71 (74%), Positives = 63/71 (88%) Frame = +2 Query: 41 IRPVYRPTIVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYGSN 220 + PV RP I+KKR K+FIRHQSDRY ++ +WRKP+GIDNRVRRRFKGQYLMPNIGYGSN Sbjct: 2 VMPVNRPRILKKRQKKFIRHQSDRYMRVGESWRKPKGIDNRVRRRFKGQYLMPNIGYGSN 61 Query: 221 KKTRHMLPNGF 253 KKTR ++P+GF Sbjct: 62 KKTRFLMPDGF 72 Score = 99.5 bits (237), Expect = 3e-21 Identities = 48/65 (73%), Positives = 54/65 (83%) Frame = +1 Query: 241 PKWIPKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNAAARLR 420 P K +VHNVKELE+LMM NR Y AEIAH VSS+KRK IVERAQQLSI+VTN+ ARLR Sbjct: 69 PDGFKKFVVHNVKELEVLMMMNRSYAAEIAHNVSSRKRKAIVERAQQLSIKVTNSNARLR 128 Query: 421 SQENE 435 S+ENE Sbjct: 129 SEENE 133 >SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 119 bits (287), Expect = 3e-27 Identities = 65/125 (52%), Positives = 76/125 (60%) Frame = +1 Query: 289 ILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNAAARLRSQENE*IXXXXXXXXX 468 +++ N K ++IA S ++ I + A N R + + E + Sbjct: 8 VVLKHNAKIGSQIAVEFSKLRQPNIAKSAPIRDSLSNNEQTRFLNNQIEFLQPGGSTSSR 67 Query: 469 XXEGGPGTQFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 648 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP Sbjct: 68 AAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 127 Query: 649 SQQLR 663 SQQLR Sbjct: 128 SQQLR 132 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 24 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 115 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 98 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 128 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 92 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 148 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 132 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 188 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 49 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 105 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 62 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 118 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 90 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 146 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 44 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 100 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 57 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 113 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 100 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 156 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 56 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 112 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 150 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 206 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 97 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 87 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 86 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 98 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 154 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 84 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 140 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 136 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 192 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 44 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 100 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 87 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 115 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 171 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 157 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 213 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 128 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 >SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 86 >SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) Length = 180 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 78 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 134 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 452 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 508 >SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 >SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 28 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 >SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 91 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 147 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 56 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 112 >SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 78 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 134 >SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 36 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 92 >SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 115 >SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 117 >SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 36 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 92 >SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 123 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 179 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 169 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 225 >SB_34190| Best HMM Match : MAM (HMM E-Value=0) Length = 384 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 66 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 122 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 98 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) Length = 331 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 229 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 285 >SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 99 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 155 >SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 >SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 >SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 76 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 132 >SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 66 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 122 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107 >SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) Length = 163 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 117 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114 >SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) Length = 204 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 102 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 158 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 97 >SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 >SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 126 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 182 >SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 87 >SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) Length = 163 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 117 >SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) Length = 504 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 132 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 188 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 >SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) Length = 195 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 93 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 149 >SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) Length = 261 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 159 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 215 >SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) Length = 136 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91 >SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) Length = 169 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 67 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 123 >SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 112 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 168 >SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 249 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 305 Score = 113 bits (272), Expect = 2e-25 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +1 Query: 511 SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 364 SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 414 >SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 80 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 136 >SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91 >SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 93 >SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 >SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 117 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 173 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 63 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 119 >SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 >SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 63 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 119 >SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 85 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 141 >SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 84 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 140 >SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 40 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 96 >SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 >SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 62 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 118 >SB_16189| Best HMM Match : rve (HMM E-Value=0.3) Length = 595 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 493 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 549 >SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 >SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) Length = 791 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 >SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 118 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 174 >SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 >SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 77 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 133 >SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 >SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 98 >SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) Length = 177 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 75 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 131 >SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 93 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 149 >SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) Length = 160 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114 >SB_12355| Best HMM Match : IncA (HMM E-Value=2) Length = 225 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 123 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 179 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 111 >SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 33 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 89 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 >SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 86 >SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) Length = 271 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 169 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 225 >SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 97 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 153 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 250 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 306 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 97 >SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 53 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 109 >SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 >SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 >SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 111 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 167 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 >SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91 >SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 111 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114 >SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 >SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 89 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 145 >SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 111 >SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 81 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 137 >SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) Length = 188 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 48 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 104 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 >SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 115 >SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 >SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 379 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 48 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 104 >SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 87 >SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 67 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 123 >SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 33 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 89 >SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 87 >SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 >SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 121 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 177 >SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 >SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 36 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 92 >SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 24 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 >SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101 >SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 98 >SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 115 >SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 96 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 152 >SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 28 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 >SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 24 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 >SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107 >SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) Length = 174 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 128 >SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 86 >SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 86 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 142 >SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 65 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 121 >SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 277 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 333 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 111 >SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 128 >SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 87 >SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 68 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 124 >SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 115 >SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 >SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107 >SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 >SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 65 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 121 >SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 66 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 122 >SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 128 >SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 111 >SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 93 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 149 >SB_49504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 93 >SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 >SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 >SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 >SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) Length = 475 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 204 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 260 >SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7) Length = 294 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 192 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 248 >SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) Length = 158 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 56 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 112 >SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) Length = 138 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 93 >SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5) Length = 237 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 136 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 192 >SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 88 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 144 >SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101 >SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 86 >SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 101 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 157 >SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 >SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 64 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 120 >SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) Length = 141 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 >SB_46342| Best HMM Match : Secretin_N_2 (HMM E-Value=6.7) Length = 156 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 118 bits (283), Expect = 9e-27 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +1 Query: 493 QFAL**SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 663 QFAL SYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 82 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 138 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,217,098 Number of Sequences: 59808 Number of extensions: 559758 Number of successful extensions: 5611 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5597 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2597949818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -