BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30433.Seq (904 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 25 4.2 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 9.6 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 9.6 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 24.6 bits (51), Expect = 4.2 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Frame = -1 Query: 190 VLTLEPPADSVVNTSRFTPIPLKFVIAIRLMP----DKSLRPLFDDCRPVNRSYSH 35 +L +EP A ++ T+ FTP + F+ A L D SL L + + ++Y H Sbjct: 787 ILDVEPQALKILRTAEFTPY-VVFIAAPLLQNIADYDGSLERLAKESDMLRQAYGH 841 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 9.6 Identities = 10/23 (43%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 254 GIHLGAYDGSSCWNRNQC-WASS 189 G +LGA ++CWN + W SS Sbjct: 2749 GAYLGAASANNCWNPLKWDWRSS 2771 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 9.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 559 NPGVTQLNRLAAHPPFASWRNS 624 +PG +L+ HPP AS R+S Sbjct: 835 HPGAQTQPQLSQHPPGASGRSS 856 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 908,705 Number of Sequences: 2352 Number of extensions: 18900 Number of successful extensions: 28 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97574436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -