BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30433.Seq (904 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 156 2e-40 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 156 bits (379), Expect = 2e-40 Identities = 69/73 (94%), Positives = 71/73 (97%) Frame = +2 Query: 35 MAIRPVYRPTIVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYG 214 MAIRPVYRPTIVKKRTK+FIRHQSDRY KLKRNWRKP+GIDNRVRRRFKGQYLMPNIGYG Sbjct: 1 MAIRPVYRPTIVKKRTKKFIRHQSDRYSKLKRNWRKPKGIDNRVRRRFKGQYLMPNIGYG 60 Query: 215 SNKKTRHMLPNGF 253 SNKKTRHMLP GF Sbjct: 61 SNKKTRHMLPTGF 73 Score = 110 bits (264), Expect = 2e-26 Identities = 55/65 (84%), Positives = 58/65 (89%) Frame = +1 Query: 241 PKWIPKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNAAARLR 420 P KVLVHNVKELE+LMMQNRK+CAEIAHG SSKKRK IVERAQQLSIRVT A+ARLR Sbjct: 70 PTGFRKVLVHNVKELEVLMMQNRKFCAEIAHGGSSKKRKSIVERAQQLSIRVTYASARLR 129 Query: 421 SQENE 435 SQENE Sbjct: 130 SQENE 134 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 246,054 Number of Sequences: 438 Number of extensions: 5175 Number of successful extensions: 15 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29267238 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -