BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30429.Seq (712 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39807| Best HMM Match : Ribosomal_S8e (HMM E-Value=0) 122 4e-28 SB_22712| Best HMM Match : Ribosomal_S8e (HMM E-Value=0.068) 36 0.032 SB_32934| Best HMM Match : K_tetra (HMM E-Value=7.79963e-42) 30 1.6 SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 29 2.8 SB_26394| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.88) 29 4.9 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 29 4.9 SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_39807| Best HMM Match : Ribosomal_S8e (HMM E-Value=0) Length = 192 Score = 122 bits (293), Expect = 4e-28 Identities = 58/84 (69%), Positives = 67/84 (79%) Frame = +3 Query: 252 QTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYTLPLGRKKGAKLTEAEE 431 + RIIDVVYNASNNELVRTKTLVKN IV VD+TPFRQWYE+HY +P+GRKK + TE E+ Sbjct: 59 KARIIDVVYNASNNELVRTKTLVKNCIVQVDSTPFRQWYEAHYAIPIGRKKTKQPTEEEQ 118 Query: 432 AIINKKRSQKTARKYLARQRLAKV 503 I+NKKRS RK AR+ AKV Sbjct: 119 EILNKKRSNHCTRKLEARKANAKV 142 Score = 91.1 bits (216), Expect = 8e-19 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +1 Query: 88 PIRKKRKYELGRPAANTRLGPQRXHSVRSRGGNTKYRALRLDTGNFSWGSECSTRK 255 P+R KRK+ELGRP ANT++G +R H VR+RGGN K+RA RLDT NFSWGSE TRK Sbjct: 4 PLRHKRKFELGRPPANTKIGTKRIHEVRTRGGNRKFRAFRLDTENFSWGSESCTRK 59 Score = 82.2 bits (194), Expect = 4e-16 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +2 Query: 512 LEEQFHTGRLLACVASRPGQCGRADGYILEGKELEFYLRKIKSKRAK 652 +EEQF TGRL ACV+SRPGQ GR DGYILEGKELEFY++K+K+++AK Sbjct: 146 MEEQFVTGRLYACVSSRPGQSGRCDGYILEGKELEFYIKKLKARKAK 192 >SB_22712| Best HMM Match : Ribosomal_S8e (HMM E-Value=0.068) Length = 147 Score = 35.9 bits (79), Expect = 0.032 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +3 Query: 261 IIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESH 377 I+ V+++ +N E + +VK +IV VD PF W++ + Sbjct: 75 ILSVMHSFANKEHIERNVIVKGSIVQVDNKPFEDWFQEY 113 >SB_32934| Best HMM Match : K_tetra (HMM E-Value=7.79963e-42) Length = 1207 Score = 30.3 bits (65), Expect = 1.6 Identities = 24/109 (22%), Positives = 39/109 (35%), Gaps = 2/109 (1%) Frame = -1 Query: 376 CDSYHCLNGVASTTTIAFLTRVFVRTNSLL--DALYTTSMIRVCELNIPIPKRSYRCPDA 203 C Y C V +TT +A + ++++ S + A+ R C N Sbjct: 700 CPGYKCATPVDNTTILALVPELYLKYTSQVRQKAVEANPSWRWCPGNKCSLVNKVTKRSC 759 Query: 202 AHGT*YFHHVNERSGFAEGRAWCLQRDALTHTSSSCVWAHVSHRWPFAY 56 HG + + A G+ WC + TH + C A + AY Sbjct: 760 YHGNTFLDYGGVPVACACGKTWCSECQEETHWPAKCEIAQRFRKQTKAY 808 >SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2537 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 64 RATGGKRAPIRKKRKYELGRPAANTRLGP 150 R GG R P+++ +E +P+ N R GP Sbjct: 769 RRGGGSRVPVKRSSSFENRKPSPNRRRGP 797 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +1 Query: 7 VFFFDPTKMGISRDHWHKRRATG--GKRAPIRKKRKYELG 120 VF P+K S+ K+ ATG GK AP +KK+K+ G Sbjct: 474 VFSDSPSKNKESKSTKRKKSATGGEGKEAPAKKKQKHNDG 513 >SB_26394| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.88) Length = 842 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 520 AIPHRAFAGLRGESPRSVW 576 A PH A +G+R SPR +W Sbjct: 108 ACPHHAVSGVRVSSPRGIW 126 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 520 AIPHRAFAGLRGESPRSVW 576 A PH A +G+R PRS+W Sbjct: 139 AYPHHAVSGVRVSPPRSIW 157 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 520 AIPHRAFAGLRGESPRSVW 576 A PH A +G+R PRS+W Sbjct: 201 ACPHHAVSGVRVSPPRSIW 219 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 520 AIPHRAFAGLRGESPRSVW 576 A PH A +G+R PRS+W Sbjct: 232 ACPHHAVSGVRVSPPRSIW 250 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 272 NINDTGLRVEHSDPQEKLPVSRRSARYLVFPPRERTEWXR 153 ++ D +RV+H + EK +S + F PR +T W + Sbjct: 114 SLRDFSIRVKHRNRMEKSTLSEFLETRVCFTPRRKTLWKK 153 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +1 Query: 61 RRATGGKRAPIRKKRKYELGRPAANTRLGPQRXHSVRSRGGNTKYR 198 RR GG R+P + R+ R R P RSR G+ + R Sbjct: 104 RRRYGGGRSPSPRGRRRSRSRSPVRRRRSPSLERRSRSRSGSRERR 149 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,024,861 Number of Sequences: 59808 Number of extensions: 431109 Number of successful extensions: 1206 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1205 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -