BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30429.Seq (712 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40799-7|AAA81485.1| 208|Caenorhabditis elegans Ribosomal prote... 128 3e-30 >U40799-7|AAA81485.1| 208|Caenorhabditis elegans Ribosomal protein, small subunitprotein 8 protein. Length = 208 Score = 128 bits (310), Expect = 3e-30 Identities = 58/87 (66%), Positives = 70/87 (80%) Frame = +3 Query: 252 QTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYTLPLGRKKGAKLTEAEE 431 +TRI+D +YNA+NNELVRTKTLVK AI+ VDA PFRQWYE+HY LPL RKK AKL+E + Sbjct: 75 KTRIVDTMYNATNNELVRTKTLVKGAIISVDAAPFRQWYEAHYALPLARKKNAKLSEEDN 134 Query: 432 AIINKKRSQKTARKYLARQRLAKVEGL 512 AI+NKKRS T +KY RQ+ A V+ L Sbjct: 135 AILNKKRSHHTMKKYTERQKTAAVDAL 161 Score = 111 bits (268), Expect = 4e-25 Identities = 51/75 (68%), Positives = 58/75 (77%) Frame = +1 Query: 31 MGISRDHWHKRRATGGKRAPIRKKRKYELGRPAANTRLGPQRXHSVRSRGGNTKYRALRL 210 MGISRD WHKR TG + KKRK+ELGRPAANT++G R VR+RGGN KYRALRL Sbjct: 1 MGISRDSWHKRYKTGATQPVPHKKRKFELGRPAANTKIGAHRVRLVRTRGGNEKYRALRL 60 Query: 211 DTGNFSWGSECSTRK 255 D+GNFSW SE +TRK Sbjct: 61 DSGNFSWASEQTTRK 75 Score = 75.4 bits (177), Expect = 4e-14 Identities = 34/47 (72%), Positives = 43/47 (91%) Frame = +2 Query: 512 LEEQFHTGRLLACVASRPGQCGRADGYILEGKELEFYLRKIKSKRAK 652 L EQF+TGRLLA ++S PGQ G+A+GYILEGKEL+FYLRKI++K+AK Sbjct: 162 LIEQFNTGRLLARISSSPGQVGQANGYILEGKELDFYLRKIRAKKAK 208 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,292,707 Number of Sequences: 27780 Number of extensions: 315442 Number of successful extensions: 885 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 885 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -