BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30428.Seq (681 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 28 0.081 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 28 0.081 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 28 0.081 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 28 0.081 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 7.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.1 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 9.3 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 9.3 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 9.3 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 21 9.3 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 9.3 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 9.3 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 27.9 bits (59), Expect = 0.081 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 99 IFLLEPLHSIFLCEAVGKSHFSCLTPSVCYVETWPAKY 212 IFL+ S F+ + F C+ P + Y+ + P+ Y Sbjct: 1006 IFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLSIPSMY 1043 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 27.9 bits (59), Expect = 0.081 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 99 IFLLEPLHSIFLCEAVGKSHFSCLTPSVCYVETWPAKY 212 IFL+ S F+ + F C+ P + Y+ + P+ Y Sbjct: 1006 IFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLSIPSMY 1043 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 27.9 bits (59), Expect = 0.081 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 99 IFLLEPLHSIFLCEAVGKSHFSCLTPSVCYVETWPAKY 212 IFL+ S F+ + F C+ P + Y+ + P+ Y Sbjct: 1006 IFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLSIPSMY 1043 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 27.9 bits (59), Expect = 0.081 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 99 IFLLEPLHSIFLCEAVGKSHFSCLTPSVCYVETWPAKY 212 IFL+ S F+ + F C+ P + Y+ + P+ Y Sbjct: 1006 IFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLSIPSMY 1043 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.4 bits (43), Expect = 7.1 Identities = 11/44 (25%), Positives = 16/44 (36%) Frame = +2 Query: 410 FITTDTKRPHCIPSLGKYRLLSCELLQHLGGTSSLSPDSPTHMF 541 F D RP +L ++ C QH+ P H+F Sbjct: 557 FRNLDANRPTGGDALSEFNFCGCGWPQHMLLPKGTEAGYPCHLF 600 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 168 LTPSVCYVETWPAKYDVKVQSINSN 242 LT +VC+V A + K SIN N Sbjct: 190 LTNAVCFVPGVVAMFSRKPCSINEN 214 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 168 LTPSVCYVETWPAKYDVKVQSINSN 242 LT +VC+V A + K SIN N Sbjct: 190 LTNAVCFVPGVVAMFSRKPCSINEN 214 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 292 QNYPWRRSCHAA 327 Q YPW R H A Sbjct: 209 QIYPWMRKVHVA 220 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 292 QNYPWRRSCHAA 327 Q YPW R H A Sbjct: 209 QIYPWMRKVHVA 220 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 194 FNVAHRRRKTGKVGFPHRLTKEDAMKWFQQK 102 FN RR+ ++ RLT+ WFQ + Sbjct: 204 FNKYLTRRRRIEIAESLRLTERQIKIWFQNR 234 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 194 FNVAHRRRKTGKVGFPHRLTKEDAMKWFQQK 102 FN RR+ ++ RLT+ WFQ + Sbjct: 204 FNKYLTRRRRIEIAESLRLTERQIKIWFQNR 234 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 292 QNYPWRRSCHAA 327 Q YPW R H A Sbjct: 209 QIYPWMRKVHVA 220 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 194 FNVAHRRRKTGKVGFPHRLTKEDAMKWFQQK 102 FN RR+ ++ RLT+ WFQ + Sbjct: 204 FNKYLTRRRRIEIAESLRLTERQIKIWFQNR 234 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,965 Number of Sequences: 336 Number of extensions: 3437 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -