BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30422.Seq (534 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 27 0.52 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 26 0.69 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 2.1 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 4.9 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 23 6.4 DQ370049-1|ABD18610.1| 64|Anopheles gambiae putative secreted ... 23 8.5 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 23 8.5 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 26.6 bits (56), Expect = 0.52 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 311 RQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPP 412 R++ +R +E +L EA A + N + QP PP Sbjct: 1101 REEDERRTEERRQLHNEANRAYRQRNRRSQPTPP 1134 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 26.2 bits (55), Expect = 0.69 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 182 WKDRSRVQRDCSCSRCDCQQACSRRIIPK 268 W S +R S+C C A +RR+ PK Sbjct: 419 WVSSSAFERLLDSSKCTCPIALARRLDPK 447 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 24.6 bits (51), Expect = 2.1 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 296 KHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGT 439 KH C + +E +++ KEA +T+NL + +A + GT Sbjct: 323 KHRLCELNREPTEREEQQMQKEAAVMARTMNLNQVCLCFRAYRVEPGT 370 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 4.9 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 151 TAPLPLMSTMSPTLYTFMYVE 89 TA +P S + PTL+ MY E Sbjct: 607 TAGVPQGSVLGPTLWNLMYNE 627 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.0 bits (47), Expect = 6.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -3 Query: 211 VTLYTRPVFPWYTLCGIP 158 V ++ RP PW+++ GIP Sbjct: 73 VGIFGRPGRPWWSVPGIP 90 >DQ370049-1|ABD18610.1| 64|Anopheles gambiae putative secreted peptide protein. Length = 64 Score = 22.6 bits (46), Expect = 8.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 319 VLSALGVLDMLNTDIDALRYNPPRT 245 +L L V+D N D YN PRT Sbjct: 9 LLGLLVVVDAANNTEDKHTYNDPRT 33 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 22.6 bits (46), Expect = 8.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 62 VPHTWNYSALHVHESVQS 115 V +TWNY+A V + V S Sbjct: 282 VENTWNYTAADVADLVDS 299 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 537,130 Number of Sequences: 2352 Number of extensions: 11129 Number of successful extensions: 33 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -