BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30421.Seq (806 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 22 5.8 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 5.8 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.2 bits (45), Expect = 5.8 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +1 Query: 529 SLRRRGVASGARSLQPSRPPRRASGDTRPPARALTIC*RRVLSLKPH 669 +LR + SL+ + S + R A+TIC VLS P+ Sbjct: 244 ALREQAKKMNVDSLRSNANTSSQSAEIRIAKAAITICFLYVLSWTPY 290 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 433 PLSQVAQCVCGPRQYPAHRPI 371 P S +A CVC + HRP+ Sbjct: 97 PNSTIAVCVCMRKCPRRHRPV 117 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 226,497 Number of Sequences: 438 Number of extensions: 5549 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25610547 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -