BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30419.Seq (894 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0182 - 2052037-2052044,2053163-2053748,2055337-2055396 32 0.71 02_04_0097 - 19673312-19673836 29 3.8 12_01_0171 - 1268803-1269500,1271491-1271567,1271941-1272065,127... 29 6.6 >10_01_0182 - 2052037-2052044,2053163-2053748,2055337-2055396 Length = 217 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +3 Query: 372 LDNSSVGIRSALNVPKSNNYVNEQIRGYIRNSHEPELSPIRATNG 506 LD+ V ++S L V + V +RG+ R HE LSP+R +G Sbjct: 140 LDSGGVELQSTLGVNVGEDLV--LVRGWPRRCHELRLSPVRGEDG 182 >02_04_0097 - 19673312-19673836 Length = 174 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -3 Query: 574 ESPVLVVRGITR*LPCWRRVDAPPLVARIGDSSGSWLFL 458 E +V + LP W R PP ++ IG WL+L Sbjct: 75 EEKTVVPAALAPPLPAWTRAAFPPPISVIGAGGKPWLYL 113 >12_01_0171 - 1268803-1269500,1271491-1271567,1271941-1272065, 1272146-1272234,1272851-1272936,1273509-1273765 Length = 443 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +1 Query: 376 TTPQWASEALSTCPKAITTSTNRSEDTSGTAMSQNCLRSGRPTVERPRVSSK 531 ++P AS + S + S++ SED+S + MS C R RP E+ +K Sbjct: 5 SSPDPASSSPSASSSPSSPSSSSSEDSS-SPMSMPCKRRARPRTEKSTGKAK 55 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,723,383 Number of Sequences: 37544 Number of extensions: 525616 Number of successful extensions: 1392 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1392 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2518669100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -