BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30418.Seq (872 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03790.2 68416.m00389 ankyrin repeat family protein / regulat... 39 0.005 At3g03790.1 68416.m00388 ankyrin repeat family protein / regulat... 39 0.005 At5g16040.1 68418.m01875 regulator of chromosome condensation (R... 37 0.015 At3g53830.1 68416.m05947 regulator of chromosome condensation (R... 37 0.015 At3g55580.1 68416.m06171 regulator of chromosome condensation (R... 36 0.027 At3g02300.1 68416.m00212 regulator of chromosome condensation (R... 36 0.035 At5g11580.1 68418.m01350 UVB-resistance protein-related / regula... 34 0.11 At5g08710.1 68418.m01035 regulator of chromosome condensation (R... 33 0.19 At1g69710.1 68414.m08022 zinc finger protein, putative / regulat... 33 0.19 At1g19880.1 68414.m02493 regulator of chromosome condensation (R... 33 0.19 At3g02510.1 68416.m00239 regulator of chromosome condensation (R... 33 0.25 At5g19420.1 68418.m02314 zinc finger protein, putative / regulat... 32 0.58 At5g12350.1 68418.m01453 zinc finger protein, putative / regulat... 32 0.58 At5g42140.1 68418.m05130 zinc finger protein, putative / regulat... 31 0.76 At4g14370.1 68417.m02214 disease resistance protein (TIR-NBS-LRR... 31 1.0 At3g15430.2 68416.m01958 regulator of chromosome condensation (R... 31 1.0 At3g15430.1 68416.m01957 regulator of chromosome condensation (R... 31 1.0 At3g26100.2 68416.m03250 regulator of chromosome condensation (R... 30 1.8 At3g26100.1 68416.m03251 regulator of chromosome condensation (R... 30 1.8 At3g23270.1 68416.m02933 regulator of chromosome condensation (R... 30 1.8 At1g67720.1 68414.m07728 leucine-rich repeat family protein / pr... 30 1.8 At5g48330.1 68418.m05970 regulator of chromosome condensation (R... 30 2.3 At1g65920.1 68414.m07480 regulator of chromosome condensation (R... 30 2.3 At1g27060.1 68414.m03299 regulator of chromosome condensation (R... 30 2.3 At5g60870.2 68418.m07635 regulator of chromosome condensation (R... 29 3.1 At5g60870.1 68418.m07636 regulator of chromosome condensation (R... 29 3.1 At1g76950.1 68414.m08958 zinc finger protein (PRAF1) / regulator... 29 3.1 At5g63860.1 68418.m08016 UVB-resistance protein (UVR8) identical... 29 4.1 At1g63740.1 68414.m07213 disease resistance protein (TIR-NBS-LRR... 29 4.1 At3g47660.1 68416.m05188 regulator of chromosome condensation (R... 29 5.4 At1g30930.1 68414.m03786 F-box family protein contains F-box dom... 29 5.4 At3g07900.1 68416.m00965 expressed protein contains Pfam PF03138... 28 7.1 At1g22710.1 68414.m02838 sucrose transporter / sucrose-proton sy... 28 7.1 >At3g03790.2 68416.m00389 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein similar to hect domain and RLD 2 GB:NP_004658 [Homo sapiens]; contains Pfam PF00415: Regulator of chromosome condensation (RCC1); contains Pfam PF00023: Ankyrin repeat; similar to rjs (GI:3414809) [Mus musculus]; similar to HERC2 (GI:4079809) [Homo sapiens] Length = 1081 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRES 684 +KAVAA + HT+I T+ VYT G+N GQ G S Sbjct: 247 VKAVAAAKHHTVIATEGGDVYTWGSNREGQLGYTS 281 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 565 SLECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 SL+ +I AV+A HT +++D V+T G N GQ G Sbjct: 293 SLKAKIVAVSAANKHTAVVSDCGEVFTWGCNKEGQLG 329 >At3g03790.1 68416.m00388 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein similar to hect domain and RLD 2 GB:NP_004658 [Homo sapiens]; contains Pfam PF00415: Regulator of chromosome condensation (RCC1); contains Pfam PF00023: Ankyrin repeat; similar to rjs (GI:3414809) [Mus musculus]; similar to HERC2 (GI:4079809) [Homo sapiens] Length = 1078 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRES 684 +KAVAA + HT+I T+ VYT G+N GQ G S Sbjct: 244 VKAVAAAKHHTVIATEGGDVYTWGSNREGQLGYTS 278 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 565 SLECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 SL+ +I AV+A HT +++D V+T G N GQ G Sbjct: 290 SLKAKIVAVSAANKHTAVVSDCGEVFTWGCNKEGQLG 326 >At5g16040.1 68418.m01875 regulator of chromosome condensation (RCC1) family protein similar to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 396 Score = 37.1 bits (82), Expect = 0.015 Identities = 23/65 (35%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Frame = +1 Query: 490 WIPFTTRNHPLELLLSYAPIYIPYKSL-ECEIKAVAAGRAHTIILTDKEGVYTLGNNAYG 666 W T HP E P + KSL +I A G H + + D+ Y G N YG Sbjct: 64 WNQRGTLGHPPETKTESTPSLV--KSLANVKIVQAAIGGWHCLAVDDQGRAYAWGGNEYG 121 Query: 667 QCGRE 681 QCG E Sbjct: 122 QCGEE 126 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 ++ +A G H + L + ++ GNN YGQ G Sbjct: 198 VRLIAVGAFHNLALKEDGTLWAWGNNEYGQLG 229 >At3g53830.1 68416.m05947 regulator of chromosome condensation (RCC1) family protein / UVB-resistance protein-related contains Pfam PF00415 : Regulator of chromosome condensation (RCC1); similar to UVB-resistance protein UVR8 (GIi;10177674) [Arabidopsis thaliana] Length = 487 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 IKA++ G H+ +TD G+ T G YGQCG Sbjct: 312 IKAISCGGRHSAAITDAGGLITFGWGLYGQCG 343 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 +++VAAG HTI ++ VY G N +GQ G Sbjct: 364 MESVAAGLWHTICISSDGKVYAFGGNQFGQLG 395 >At3g55580.1 68416.m06171 regulator of chromosome condensation (RCC1) family protein UVB-resistance protein UVR8, Arabidopsis thaliana, EMBL:AF130441; contains Pfam PF00415: Regulator of chromosome condensation (RCC1) domain Length = 488 Score = 36.3 bits (80), Expect = 0.027 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRES 684 +K +A G H+ ++TD + T G YGQCG+ S Sbjct: 313 VKKIACGGRHSAVITDTGALLTFGWGLYGQCGQGS 347 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 +K ++ G HT ++TD+ V+ G N YGQ G Sbjct: 419 VKTISCGARHTAVITDEGRVFCWGWNKYGQLG 450 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 568 LECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 L I+ VAAG HT + VY G N +GQ G Sbjct: 361 LGIRIEEVAAGLWHTTCASSDGDVYAFGGNQFGQLG 396 >At3g02300.1 68416.m00212 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 471 Score = 35.9 bits (79), Expect = 0.035 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = +1 Query: 523 ELLLSYAPIYIPYKSLECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRE-SKCQWK 699 E+LL P+ + + +++ VA G +HT++ + + G N+YGQ E S W Sbjct: 331 EMLLRNVPVLV----IPTDVRLVACGHSHTLVYMREGRICGWGYNSYGQAANEKSSYAWY 386 Query: 700 SIKVVW*LITYKSLGXG 750 V W + + L G Sbjct: 387 PSPVDWCVGQVRKLAAG 403 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 577 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRES 684 +I ++ G HT L+D VYT G + GQ G S Sbjct: 228 KIMQLSCGEYHTAALSDAGEVYTWGLGSMGQLGHVS 263 >At5g11580.1 68418.m01350 UVB-resistance protein-related / regulator of chromosome condensation (RCC1) family protein contains Pfam PF00415 : Regulator of chromosome condensation (RCC1); similar to rjs protein (GI:3414809) [Mus musculus]; similar to HERC2 (GI:4079809) [Homo sapiens];similar to UVB-resistance protein UVR8 (GI:10177674) {Arabidopsis thaliana} Length = 553 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 541 APIYIPYKSLECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 +P + + L +I ++AAG AHTI LT VY+ G +G+ G Sbjct: 5 SPTLLISEDLSRKIISLAAGEAHTIALTGDGCVYSWGRGMFGRLG 49 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 I VAAG H++ ++D V+ G N YGQ G Sbjct: 75 IVGVAAGAYHSLAVSDDGSVWCWGYNIYGQLG 106 >At5g08710.1 68418.m01035 regulator of chromosome condensation (RCC1) family protein / UVB-resistance protein-related contains Pfam PF00415 : Regulator of chromosome condensation (RCC1); similar to UVB-resistance protein UVR8 (GI:10177674) {Arabidopsis thaliana} Length = 434 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 I AVA G AHT+ LT+ V+ G N GQ G Sbjct: 84 ITAVACGGAHTLFLTETRRVFATGLNDCGQLG 115 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +2 Query: 350 WHPMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIG 493 W P S IT +ACG T+ +E +VF TG+N Q+G Sbjct: 71 WTPAVCSALSDHSITAVACGGAHTLF---LTETRRVFATGLNDCGQLG 115 >At1g69710.1 68414.m08022 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1028 Score = 33.5 bits (73), Expect = 0.19 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 568 LECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 +E ++ +A G H +LT K +YT G GQ G Sbjct: 561 VEASVEEIACGSYHVAVLTSKSEIYTWGKGLNGQLG 596 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 589 VAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 VA G + T+ T + VYT+G+ AYGQ G Sbjct: 516 VACGHSLTVSRTSRGHVYTMGSTAYGQLG 544 >At1g19880.1 68414.m02493 regulator of chromosome condensation (RCC1) family protein low similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 538 Score = 33.5 bits (73), Expect = 0.19 Identities = 20/41 (48%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEG-VYTLGNNAYGQCG-RESKCQW 696 I VA G HT+ + DK G VYT G YG+ G RE K +W Sbjct: 237 IVKVACGTNHTVAV-DKNGYVYTWGFGGYGRLGHREQKDEW 276 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 577 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 +I AAGR HT++++D G N YGQ G Sbjct: 111 KIVKAAAGRNHTVVVSDDGQSLGFGWNKYGQLG 143 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +2 Query: 386 DITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPRE 511 ++TN+ACG FTV + ++E + G+ Q+G+ + E Sbjct: 168 EVTNVACGADFTV-WLSSTEGASILTAGLPQYGQLGHGTDNE 208 >At3g02510.1 68416.m00239 regulator of chromosome condensation (RCC1) family protein similar to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 393 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 577 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRE 681 +I A G H + + D+ Y G N YGQCG E Sbjct: 92 KITQAAIGGWHCLAVDDQGRAYAWGGNEYGQCGEE 126 Score = 29.1 bits (62), Expect = 4.1 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 553 IPYKSLE-CEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 +P + L+ + +AAG H+ LTDK VY G +G+ G Sbjct: 240 VPVQGLDDLTLVDIAAGGWHSTALTDKGEVYGWGRGEHGRLG 281 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 ++ +A G H + L + + GNN YGQ G Sbjct: 198 VRLIAVGAFHNLALEEDGRLLAWGNNEYGQLG 229 >At5g19420.1 68418.m02314 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1124 Score = 31.9 bits (69), Expect = 0.58 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 589 VAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 VA G + T+ LT VYT+G+ YGQ G Sbjct: 557 VACGHSLTVALTTSGHVYTMGSPVYGQLG 585 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 ++ +A G H +LT + VYT G + G+ G Sbjct: 606 VEEIACGAYHVAVLTSRTEVYTWGKGSNGRLG 637 >At5g12350.1 68418.m01453 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1062 Score = 31.9 bits (69), Expect = 0.58 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 589 VAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 VA G + T+ LT VYT+G+ YGQ G Sbjct: 521 VACGHSLTVALTTSGHVYTMGSPVYGQLG 549 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 ++ +A G H +LT + VYT G + G+ G Sbjct: 570 VEEIACGAYHVAVLTSRTEVYTWGKGSNGRLG 601 >At5g42140.1 68418.m05130 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1073 Score = 31.5 bits (68), Expect = 0.76 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 589 VAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 VA G + T+ LT VYT+G+ YGQ G Sbjct: 499 VACGHSLTVGLTTSGKVYTMGSTVYGQLG 527 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 ++ +A G H +LT + V+T G A G+ G Sbjct: 548 VEEIACGAYHVAVLTSRNEVFTWGKGANGRLG 579 >At4g14370.1 68417.m02214 disease resistance protein (TIR-NBS-LRR class), putative similar to zinc finger protein (GI:15811367) [Arabidopsis thaliana]; similar to TIR-NBS-LRR (GI:27466164) [Arabidopsis thaliana]; similar to disease resistance protein RPP1-WsB (GI:3860165) [Arabidopsis thaliana] Length = 1996 Score = 31.1 bits (67), Expect = 1.0 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 2/67 (2%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRESKCQWKSIKVVW*LIT--YKSLGXGS 753 ++ ++ G H +LT + V+T G + G+ G K K+ +V L KS+ G+ Sbjct: 1477 VEEISCGDHHVAVLTSRSEVFTWGKGSNGRLGHGDKDDRKTPTLVEALRERHVKSISCGA 1536 Query: 754 XX*VCCG 774 VC G Sbjct: 1537 DQSVCSG 1543 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +1 Query: 568 LECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 ++ +A G T+ LT V+T+G ++GQ G Sbjct: 1421 IDYNFNQIACGHTFTVALTTSGHVFTMGGTSHGQLG 1456 >At3g15430.2 68416.m01958 regulator of chromosome condensation (RCC1) family protein low similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 488 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 583 KAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 K VAAG T+ L+ + YT G+N +GQ G Sbjct: 219 KQVAAGLHFTVFLSREGHAYTCGSNTHGQLG 249 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +1 Query: 568 LEC----EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRES 684 LEC + V+ G HTI++T + ++ G+N Q G +S Sbjct: 424 LECLKPHRVSQVSTGLYHTIVVTQRGRIFGFGDNERAQLGHDS 466 >At3g15430.1 68416.m01957 regulator of chromosome condensation (RCC1) family protein low similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 488 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 583 KAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 K VAAG T+ L+ + YT G+N +GQ G Sbjct: 219 KQVAAGLHFTVFLSREGHAYTCGSNTHGQLG 249 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +1 Query: 568 LEC----EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRES 684 LEC + V+ G HTI++T + ++ G+N Q G +S Sbjct: 424 LECLKPHRVSQVSTGLYHTIVVTQRGRIFGFGDNERAQLGHDS 466 >At3g26100.2 68416.m03250 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 532 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +1 Query: 577 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 E AG H++ +T K VYT G N GQ G Sbjct: 144 EKSQAVAGPGHSVAVTSKGEVYTFGYNNSGQLG 176 >At3g26100.1 68416.m03251 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 432 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +1 Query: 577 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 E AG H++ +T K VYT G N GQ G Sbjct: 44 EKSQAVAGPGHSVAVTSKGEVYTFGYNNSGQLG 76 >At3g23270.1 68416.m02933 regulator of chromosome condensation (RCC1) family protein contains Pfam domain PF00415: Regulator of chromosome condensation (RCC1); similar to zinc finger protein (GI:15811367) [Arabidopsis thaliana]; similar to chromosome condensation regulator protein (GI:22770461) [Cicer arietinum] Length = 1045 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 589 VAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 +A G T+ LT V+T+G A+GQ G Sbjct: 477 IACGHTFTVALTTSGHVFTMGGTAHGQLG 505 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 ++ +A G H +LT + V+T G A G+ G Sbjct: 526 VEEIACGAHHVAVLTSRSEVFTWGKGANGRLG 557 >At1g67720.1 68414.m07728 leucine-rich repeat family protein / protein kinase family protein contains similarity to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains Pfam doamins PF00069: Protein kinase domain and PF00560: Leucine Rich Repeat Length = 929 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 285 WVSTSHVARKGKKVTKTTSNWFGIQ 359 WVS S + ++GK VT +NW +Q Sbjct: 46 WVSDSEIIKQGKPVTLANTNWNSMQ 70 >At5g48330.1 68418.m05970 regulator of chromosome condensation (RCC1) family protein contains Pfam PF00415:Regulator of chromosome condensation (RCC1) domain (5 copies); similar to UVB-resistance protein UVR8 (GI:5478530) {Arabidopsis thaliana) Length = 455 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 577 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRESK 687 ++ +A G H++IL + + G+N YGQ GR + Sbjct: 287 KVADIACGSDHSLILCHDGTLLSAGSNIYGQLGRSKQ 323 >At1g65920.1 68414.m07480 regulator of chromosome condensation (RCC1) family protein / zinc finger protein-related contains Pfam profiles: regulator of chromosome condensation (RCC1), PF01363 FYVE zinc finger Length = 1006 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 +K +A+G H +LT VYT G GQ G Sbjct: 565 VKDIASGSHHVAVLTSFGNVYTWGKGMNGQLG 596 >At1g27060.1 68414.m03299 regulator of chromosome condensation (RCC1) family protein low similiarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 386 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 I AAG +H+ ++D ++T GN ++GQ G Sbjct: 102 ITQAAAGWSHSGFVSDSGCIFTCGNGSFGQLG 133 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 I +A G AH I LT V+T G + GQ G Sbjct: 50 ISMLACGGAHVIALTSGGKVFTWGRGSSGQLG 81 >At5g60870.2 68418.m07635 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 383 Score = 29.5 bits (63), Expect = 3.1 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = +2 Query: 350 WHPMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPR 508 W PM E IT IACG G+ S+ +E+ KV G Q+G S R Sbjct: 234 WEPMPVPSLEGVRITQIACG-GY--HSLALTEEGKVLSWGHGGHGQLGSSSLR 283 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 571 ECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRE 681 E I+ +A G H++ LT + V+T G +G G + Sbjct: 82 EHSIRCIALGGLHSVALTHQGDVFTWGYGGFGALGHK 118 >At5g60870.1 68418.m07636 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 445 Score = 29.5 bits (63), Expect = 3.1 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = +2 Query: 350 WHPMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPR 508 W PM E IT IACG G+ S+ +E+ KV G Q+G S R Sbjct: 303 WEPMPVPSLEGVRITQIACG-GY--HSLALTEEGKVLSWGHGGHGQLGSSSLR 352 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 571 ECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRE 681 E I+ +A G H++ LT + V+T G +G G + Sbjct: 151 EHSIRCIALGGLHSVALTHQGDVFTWGYGGFGALGHK 187 >At1g76950.1 68414.m08958 zinc finger protein (PRAF1) / regulator of chromosome condensation (RCC1) family protein identical to zinc finger protein PRAF1 [Arabidopsis thaliana] gi|15811367|gb|AAL08940. Length = 1103 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 589 VAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 +A G + T+ LT V+T+G+ YGQ G Sbjct: 510 IACGHSLTVGLTTSGQVFTMGSTVYGQLG 538 >At5g63860.1 68418.m08016 UVB-resistance protein (UVR8) identical to UVB-resistance protein UVR8 (GI:5478530, GB:AAD43920.1) [Arabidopsis thaliana]; contains Pfam 00415: Regulator of chromosome condensation (RCC1) Length = 440 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 IK VAAG HT +T+ +Y G YG G Sbjct: 174 IKMVAAGAEHTAAVTEDGDLYGWGWGRYGNLG 205 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 577 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 ++ VA G HTI ++ +YT G + YGQ G Sbjct: 225 KMSMVACGWRHTISVSYSGALYTYGWSKYGQLG 257 >At1g63740.1 68414.m07213 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 992 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 440 SEQHKVFGTGINTDSQIGYHSPREIILWNFCLAMHLFI 553 SEQ + G ++D ++ +H + + W FC H F+ Sbjct: 950 SEQVSEYEDGYHSDRRLEFHEQKSLPGWGFCGIFHGFL 987 >At3g47660.1 68416.m05188 regulator of chromosome condensation (RCC1) family protein contains Pfam domain PF00415: Regulator of chromosome condensation (RCC1) Length = 951 Score = 28.7 bits (61), Expect = 5.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 580 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 675 +KA++ G HT +T + ++T G+ +G G Sbjct: 405 VKAISCGPWHTAFVTSEGKLFTFGDGTFGALG 436 >At1g30930.1 68414.m03786 F-box family protein contains F-box domain Pfam:PF00646 Length = 376 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/64 (25%), Positives = 30/64 (46%), Gaps = 7/64 (10%) Frame = -3 Query: 627 VGQDYCVSTSRCHCFNLTLQALVR-------YINRCIAKQKFQRMISRGEWYPIWESVLI 469 V + S +RCHC + +A+ R ++ R A+ + ++ GEW W + + Sbjct: 14 VSRSTAKSVARCHCVSKQWRAIFRRKYFIELFLTRSKARPRILFVVQDGEWSE-WSFLSL 72 Query: 468 PVPK 457 P P+ Sbjct: 73 PQPQ 76 >At3g07900.1 68416.m00965 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'auxin-independent growth promoter -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 579 Score = 28.3 bits (60), Expect = 7.1 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 174 KKVHDPSEEELLPIFQYPISKSTDRRVMCGDLLRQVLWVSTSHVARKGKKVTK 332 KK+ P++ +LP F T+ M L RQ L +++ G+ VTK Sbjct: 512 KKIITPNKRHMLPYFVNSSLTETEFEKMIKKLHRQSLGQPELRISKAGRDVTK 564 >At1g22710.1 68414.m02838 sucrose transporter / sucrose-proton symporter (SUC2) nearly identical to sucrose-proton symporter SUC2 [Arabidopsis thaliana] GI:407092 Length = 512 Score = 28.3 bits (60), Expect = 7.1 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 615 YCVSTSRCHCFNLTLQALVRYINRCIAKQK 526 YC + C ++TL +V +++ C K+K Sbjct: 218 YCANLKTCFFLSITLLLIVTFVSLCYVKEK 247 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,541,624 Number of Sequences: 28952 Number of extensions: 356254 Number of successful extensions: 868 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2048424000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -