BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30417.Seq (825 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4B4.08 |ght2||hexose transporter Ght2 |Schizosaccharomyces p... 28 1.8 SPCC548.06c |ght8||hexose transporter Ght8 |Schizosaccharomyces ... 27 3.2 SPCC1235.14 |ght5||hexose transporter Ght5 |Schizosaccharomyces ... 26 5.6 >SPBC4B4.08 |ght2||hexose transporter Ght2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 531 Score = 27.9 bits (59), Expect = 1.8 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 663 TEDPGSDKNRVKSVXKXEGAGSPTTWGHIQGRSHRXXT 776 +E+ ++ +R+KS E AG P +W I G+ R T Sbjct: 233 SEEVQNEYHRLKSSIDEEFAGGPCSWASIFGKDIRYRT 270 >SPCC548.06c |ght8||hexose transporter Ght8 |Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 27.1 bits (57), Expect = 3.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 693 VKSVXKXEGAGSPTTWGHIQGRSHRXXT 776 +K+ + E AG P TWG I G R T Sbjct: 239 IKTDCEAEMAGGPATWGDILGADIRYRT 266 >SPCC1235.14 |ght5||hexose transporter Ght5 |Schizosaccharomyces pombe|chr 3|||Manual Length = 546 Score = 26.2 bits (55), Expect = 5.6 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = +3 Query: 636 LTIEANVISTEDPGSDKNRVKSVXKXEGAGSPTTWGHIQGRSHRXXT 776 L IE VI TE + +KS + E AG P TW I G R T Sbjct: 225 LPIEHEVIQTE-----YHVIKSDCEAELAGGPATWPEIFGPDIRYRT 266 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,510,845 Number of Sequences: 5004 Number of extensions: 39506 Number of successful extensions: 88 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 404442380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -