BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30417.Seq (825 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0091 + 664913-664985,665281-665576,667197-667311,667901-66... 30 2.6 06_01_1202 + 10389090-10389140,10389218-10389853,10390355-103904... 29 3.4 11_07_0008 + 27296049-27296395,27296681-27296963,27297575-27297595 29 4.5 09_02_0273 - 6577272-6577292,6577904-6578186,6578472-6578818 29 4.5 01_06_0735 - 31579201-31579208,31579402-31579467,31580222-315803... 28 7.8 01_05_0191 - 19091991-19093223 28 7.8 >08_01_0091 + 664913-664985,665281-665576,667197-667311,667901-667971 Length = 184 Score = 29.9 bits (64), Expect = 2.6 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 2/69 (2%) Frame = +3 Query: 111 QEDHNGEFLRCGSSEQIRSFLGR*DRSS*CVKSA--RAGEGAQKEDQRSRKENKGKPEPK 284 Q+ G FL G E+ RS + + SA R GE A+ +D+ +R +GK Sbjct: 20 QKAEKGNFLEVGEEERSRSEARMGRKRKELLSSAPWRTGEAAEDDDEAARLSREGKVSVT 79 Query: 285 PAKGVTVPT 311 G T PT Sbjct: 80 SNPGET-PT 87 >06_01_1202 + 10389090-10389140,10389218-10389853,10390355-10390439, 10390536-10390654,10391251-10391318,10391401-10391710 Length = 422 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 219 GEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQ 335 G+G K+D++ K+ K K +P P T P K K + Sbjct: 355 GKGKGKKDEKEDKDKKIKRKPSPTVQATTPPAKRRKNNE 393 >11_07_0008 + 27296049-27296395,27296681-27296963,27297575-27297595 Length = 216 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 219 GEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQ 335 G+G K+D++ K+ K K +P P T P K K + Sbjct: 148 GKGKGKKDEKEDKDKKIKRKPSPIVQATTPPAKRRKNNE 186 >09_02_0273 - 6577272-6577292,6577904-6578186,6578472-6578818 Length = 216 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 219 GEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQ 335 G+G K+D++ K+ K K +P P T P K K + Sbjct: 148 GKGKGKKDEKEDKDKKIKRKPSPIVQATTPPAKRRKNNE 186 >01_06_0735 - 31579201-31579208,31579402-31579467,31580222-31580307, 31580396-31580430,31580586-31580669,31580754-31580843, 31581267-31581304,31582042-31582108 Length = 157 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/49 (24%), Positives = 27/49 (55%) Frame = +3 Query: 231 QKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQNVKSQXHQKWRTTE 377 + E++ S E++GK + K +G+ + + +N+K++ +TTE Sbjct: 51 ESEEEESEDESEGKAKHKGTEGLIQIENPNLVKAKNIKAKEVDLGKTTE 99 >01_05_0191 - 19091991-19093223 Length = 410 Score = 28.3 bits (60), Expect = 7.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 714 EGAGSPTTWGHIQGRSHRXXTKXVL 788 +G P TW HI+G H +K +L Sbjct: 137 QGTAYPVTWMHIRGSEHLHISKLIL 161 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,751,207 Number of Sequences: 37544 Number of extensions: 302916 Number of successful extensions: 841 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 841 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2268190812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -