BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30417.Seq (825 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 27 0.53 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 27 0.70 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 26 1.6 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 24 4.9 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 24 4.9 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 6.5 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 27.5 bits (58), Expect = 0.53 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -2 Query: 368 SPLLMXLRLHILSFLNALPGGNGYAFSGLGFR 273 S L LRLH + F++ G GYAF F+ Sbjct: 768 SAFLHTLRLHWVEFMSKFYEGLGYAFKPFSFK 799 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 27.1 bits (57), Expect = 0.70 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 216 AGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRK 317 A EGA K ++ ++G+P PKP + +T T++ Sbjct: 130 AAEGAPKPQRKL--SDRGEPPPKPDRRITTTTQQ 161 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 25.8 bits (54), Expect = 1.6 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 368 SPLLMXLRLHILSFLNALPGGNGYAFSGLGFR 273 S L LRLH + F++ G GY F F+ Sbjct: 808 SAFLHTLRLHWVEFMSKFYEGLGYGFQPFSFK 839 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 24.2 bits (50), Expect = 4.9 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = +3 Query: 228 AQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQN 338 AQ +D++ R N+G+ P+P + +P +K+ ++ Sbjct: 89 AQTQDEQ-RALNEGEVPPEPVANIHIPKLSELKDLKH 124 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 24.2 bits (50), Expect = 4.9 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = +3 Query: 228 AQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQN 338 AQ +D++ R N+G+ P+P + +P +K+ ++ Sbjct: 89 AQTQDEQ-RALNEGEVPPEPVANIHIPKLSELKDLKH 124 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 6.5 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -1 Query: 516 DDRKLASRWPRSSFLVFCGT 457 DD KL+ W F +FC T Sbjct: 1609 DDSKLSFSWNGQEFNLFCST 1628 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,527 Number of Sequences: 2352 Number of extensions: 10396 Number of successful extensions: 22 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87734433 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -