BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30411.Seq (515 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29B5.03c |rpl26||60S ribosomal protein L26|Schizosaccharomyc... 112 3e-26 SPAC328.03 |tps1||alpha,alpha-trehalose-phosphate synthase [UDP-... 25 5.1 SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pom... 25 6.7 SPCC285.14 |||TRAPP complex subunit Trs130 |Schizosaccharomyces ... 25 6.7 SPBC15C4.02 |||ABC1 kinase family protein|Schizosaccharomyces po... 25 6.7 SPAC22F8.06 |pam1||20S proteasome component beta 6|Schizosacchar... 25 8.9 >SPBC29B5.03c |rpl26||60S ribosomal protein L26|Schizosaccharomyces pombe|chr 2|||Manual Length = 126 Score = 112 bits (270), Expect = 3e-26 Identities = 49/83 (59%), Positives = 69/83 (83%) Frame = +3 Query: 6 MKFNKQVTSSRRKNRKRHFSAPSHIXRVLMSSPLSKELRQKFNVKSMPIRKDDEVQVVRG 185 MKF++ VTSSRRK RK HF APS + RVLMS+PLSKELR+++ ++S+P+R+DD++ V+RG Sbjct: 1 MKFSRDVTSSRRKQRKAHFGAPSSVRRVLMSAPLSKELREQYKIRSLPVRRDDQITVIRG 60 Query: 186 HYKGQQVGKVMQVYRKKFVVYIE 254 KG++ GK+ VYRKKF++ IE Sbjct: 61 SNKGRE-GKITSVYRKKFLLLIE 82 Score = 46.4 bits (105), Expect = 3e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 257 IQREKANGATAYVGIHPSKCVIVKLKMNKDRKAILDRR 370 + REKANGA+A VGI SK VI KL ++KDRK ++ R+ Sbjct: 84 VTREKANGASAPVGIDASKVVITKLHLDKDRKDLIVRK 121 >SPAC328.03 |tps1||alpha,alpha-trehalose-phosphate synthase [UDP-forming]|Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 25.4 bits (53), Expect = 5.1 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 293 VGIHPSKCV-IVKLKMNKDRKAILDRRAKGRLAALGKDKGKY 415 +GI P K +K + KDR A ++RR +G +G D+ Y Sbjct: 256 IGIDPEKFSDALKSDVVKDRIASIERRLQGVKVIVGVDRLDY 297 >SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pombe|chr 1|||Manual Length = 986 Score = 25.0 bits (52), Expect = 6.7 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 415 VFTLVFAKCSQSALCSAIEDCFAVFIH 335 +F LV S +C IED F IH Sbjct: 588 LFNLVATNASDPYICGIIEDTFEDIIH 614 >SPCC285.14 |||TRAPP complex subunit Trs130 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1150 Score = 25.0 bits (52), Expect = 6.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 223 CIVKSLLYTLRDSKRKGQWCNSICRHSP 306 C K LLY R R +W N I SP Sbjct: 388 CCAKILLYARRQLTRMARWNNLIDDSSP 415 >SPBC15C4.02 |||ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 594 Score = 25.0 bits (52), Expect = 6.7 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = -1 Query: 281 HHWPFLFESLNVYNKLFTIHLHHFANLLAFVVSTYNLNFIVF 156 ++W F S N+ F +H+H L+ + S Y++ F+ F Sbjct: 20 NYWHFWLRSFMSNNRKFLVHIH----LIPHLNSLYSICFLGF 57 >SPAC22F8.06 |pam1||20S proteasome component beta 6|Schizosaccharomyces pombe|chr 1|||Manual Length = 225 Score = 24.6 bits (51), Expect = 8.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 175 LYVDTTKANRLAK*CRCIVKSLLYTLR 255 LY D + A+ C C+V++LLY R Sbjct: 78 LYHDNHERKMSAQSCACMVRTLLYGKR 104 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,897,364 Number of Sequences: 5004 Number of extensions: 39587 Number of successful extensions: 135 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -