BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30410.Seq (640 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 26 0.30 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.0 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 6.6 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 25.8 bits (54), Expect = 0.30 Identities = 23/60 (38%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = -3 Query: 320 NSYL-GLSVL-NCQL--HSDLETLPVLVALAMSSPTFLGDRPRGPILGAKDDVAPTSPPT 153 NSYL LS+ N QL H PV + P+ + PIL K V+PT+PPT Sbjct: 44 NSYLFSLSLAQNNQLFTHHKAPIRPVALPPKREIPS---PKRSSPILAEKVSVSPTTPPT 100 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 248 PQGLEGSQDHCAADSSKQTSPD 313 P GL ++DHC + + PD Sbjct: 2266 PNGLFWNKDHCDWPENTECHPD 2287 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 389 KYQTQRQHLP*RCNRHCEDHEKQ 457 K + Q+ H P + RH E+ +KQ Sbjct: 352 KRKRQKYHDPSQLLRHVEESDKQ 374 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,325 Number of Sequences: 336 Number of extensions: 3480 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -