BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30409.Seq (872 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 24 2.1 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 24 2.1 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 8.5 AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced prot... 22 8.5 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.8 bits (49), Expect = 2.1 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 594 PQHFTCPTTTTSNQ*SGKTWCCMG 523 P+ CP ++ + KT+CC G Sbjct: 438 PEEILCPHFNVTDGETTKTFCCKG 461 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 649 NKSTTTSPALVHGEAHHEASALHVPNNHH 563 + S + SP+L+ + H + + NNHH Sbjct: 39 SSSRSPSPSLLTSQPHQDHNKEKSKNNHH 67 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 8.5 Identities = 6/30 (20%), Positives = 16/30 (53%) Frame = +1 Query: 412 VLDPAQDHQPITEASYVNIPVIALCNTDSP 501 ++DP ++++ E + IP++ + P Sbjct: 167 IVDPVEENETYDEFDTIRIPIVRSLSKSPP 196 >AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced protein 75 protein. Length = 87 Score = 21.8 bits (44), Expect = 8.5 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +1 Query: 184 CDQLASYLGKTCSGCSCCRSHREPADVFVISSRPFGQRAV 303 CD G CS S S + + FV S+ F +R++ Sbjct: 7 CDLATPRTGTNCSSGSSSDSDGQTDEGFVGDSQGFFRRSI 46 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 256,015 Number of Sequences: 438 Number of extensions: 5963 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28280841 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -