BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30407.Seq (929 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding pr... 27 1.1 AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 prot... 26 1.9 AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding pr... 25 3.3 DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 25 4.3 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 24 5.7 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 5.7 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 10.0 >AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding protein AgamOBP52 protein. Length = 170 Score = 26.6 bits (56), Expect = 1.1 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 439 IIYAWFTAMHQCPLEFNSHP-HIPPYK 516 +++ FT +CPL F+ HP PP K Sbjct: 1 MLFKLFTIPFRCPLFFSKHPKQFPPSK 27 >AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 protein. Length = 128 Score = 25.8 bits (54), Expect = 1.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 82 ADAAVDKKEVAPEEVTSTEPKESPVKKSPAKKVEAAESN 198 +DA K+ E+ E K+ PVKK P K++ + N Sbjct: 65 SDAREMMKKFKVGELIEAERKQIPVKKEPDWKMDQQDDN 103 >AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding protein AgamOBP14 protein. Length = 188 Score = 25.0 bits (52), Expect = 3.3 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = -1 Query: 290 ITVLRCIVAFFGSPFSAGESSGASSVPFSLPLLSAASTFLAGDFL 156 I L ++ SA ++S +P + A STF+ DFL Sbjct: 6 IATLTVLLVLLAGTASAKKASTIFGMPLQQDPVPATSTFIVSDFL 50 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 24.6 bits (51), Expect = 4.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 341 IKSHRFPLHTSLFLFCGITVLRCIVAFFG 255 I H F L T LF F +T++ + A G Sbjct: 202 IIQHSFELSTFLFFFAPMTMITILYALIG 230 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 24.2 bits (50), Expect = 5.7 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 Query: 76 TMADAAVDKKEVAPEEVTSTEPKESPVKKSP 168 T AV P E+ T+P SP++ +P Sbjct: 171 TNTTIAVQPAPTQPHELVGTDPLSSPLQAAP 201 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 24.2 bits (50), Expect = 5.7 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 773 GSVPGPSEKAHGSVNXLPPLNLRGTSSLGWN 681 G+ P + A GS+ +PP NL ++L ++ Sbjct: 360 GAFPIDAYSAFGSIPGMPPANLFNPAALAYH 390 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.4 bits (48), Expect = 10.0 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 178 VEAAESNGKENGTDEAPEDSPAENGEPKKAT 270 ++ A+SNG E+G ++ ED ++ + T Sbjct: 1812 LQHADSNGGEDGNEDDDEDDEDDDDDDDDTT 1842 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 754,266 Number of Sequences: 2352 Number of extensions: 12128 Number of successful extensions: 43 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 101295495 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -