BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30404.Seq (884 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 26 0.34 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.4 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 3.2 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 26.2 bits (55), Expect = 0.34 Identities = 17/75 (22%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Frame = -2 Query: 478 FVLAFSAFFLWMYSMSTRLFLNTLPFAFM*SEWYRCLSIFLAVLYFRSNFLRTLC-LCTH 302 + L FS ++ + F +++ F SE + +++ YFR + +T C L T Sbjct: 353 YTLVFSVLKQYVMQQQVKNFRHSVRSVFFLSEIFGLVNLKYRETYFRLSKTKTFCTLVTA 412 Query: 301 SSFCGIRALAVPLLL 257 +C + + LL Sbjct: 413 LVYCSLAIFVLCELL 427 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/30 (26%), Positives = 14/30 (46%) Frame = +3 Query: 162 WSRHQETCSSPLPRPCPQKHRGT*KGSSLW 251 W++ ++ C P C +K G +S W Sbjct: 1137 WNKERKICDWPKSAKCEEKKPGHKPSTSSW 1166 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 162 ILDHLTDVLSGVGVCDLI 109 IL H+ SG+ +CDLI Sbjct: 252 ILWHIVGTFSGIFLCDLI 269 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,431 Number of Sequences: 336 Number of extensions: 4530 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24513621 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -