BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30401.Seq (594 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 25 0.64 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 7.8 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 24.6 bits (51), Expect = 0.64 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = -3 Query: 298 RVRXXGGAPPTAAXRTRSNIKPSSVYILSLEFLFHLIYMVLWIENKR*LLYGR 140 RVR G PP T + SS+ + ++F + W + + L YG+ Sbjct: 55 RVRPNYGGPPVEVGVTMYVLSISSLSEVKMDFTLDFYFRQFWTDPR--LAYGK 105 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.0 bits (42), Expect = 7.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 232 SSVYILSLEFLFHLIYMV 179 S VY+L L L L+YMV Sbjct: 267 SVVYVLILYILESLLYMV 284 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,334 Number of Sequences: 336 Number of extensions: 1832 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -