Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30401.Seq
         (594 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride c...    23   2.3  
DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride c...    23   3.0  
L10433-1|AAA27732.1|  149|Apis mellifera transposase protein.          21   6.9  
L10430-1|AAA27731.1|  150|Apis mellifera transposase protein.          21   6.9  
AY155490-1|AAO12861.1|  342|Apis mellifera Ammar1 transposase pr...    21   6.9  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   6.9  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   6.9  

>DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 12/44 (27%), Positives = 18/44 (40%)
 Frame = -3

Query: 298 RVRXXGGAPPTAAXRTRSNIKPSSVYILSLEFLFHLIYMVLWIE 167
           RVR   G PP     T   +  SSV  + ++F     +   W +
Sbjct: 26  RVRPNYGGPPVEVGVTMYVLSISSVSEVLMDFTLDFYFRQFWTD 69


>DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 11/44 (25%), Positives = 18/44 (40%)
 Frame = -3

Query: 298 RVRXXGGAPPTAAXRTRSNIKPSSVYILSLEFLFHLIYMVLWIE 167
           RVR   G PP     T   +  SS+  + ++F     +   W +
Sbjct: 26  RVRPNYGGPPVEVGVTMYVLSISSLSEVKMDFTLDFYFRQFWTD 69


>L10433-1|AAA27732.1|  149|Apis mellifera transposase protein.
          Length = 149

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +1

Query: 532 IHRKXILLXAFW 567
           IHRK +LL  +W
Sbjct: 61  IHRKKVLLSVWW 72


>L10430-1|AAA27731.1|  150|Apis mellifera transposase protein.
          Length = 150

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +1

Query: 532 IHRKXILLXAFW 567
           IHRK +LL  +W
Sbjct: 62  IHRKKVLLLVWW 73


>AY155490-1|AAO12861.1|  342|Apis mellifera Ammar1 transposase
           protein.
          Length = 342

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +1

Query: 532 IHRKXILLXAFW 567
           IHRK +LL  +W
Sbjct: 183 IHRKKVLLSVWW 194


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = -3

Query: 247  SNIKPSSVYILSLE 206
            +N++PSSVY L +E
Sbjct: 1560 TNLQPSSVYQLKVE 1573


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = -3

Query: 247  SNIKPSSVYILSLE 206
            +N++PSSVY L +E
Sbjct: 1556 TNLQPSSVYQLKVE 1569


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 128,372
Number of Sequences: 438
Number of extensions: 2117
Number of successful extensions: 9
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17359926
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)