BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30398.Seq (865 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 25 1.0 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 4.1 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 23 4.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 9.4 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 9.4 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 9.4 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 9.4 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 170 RFLKFVLQQSGLNQVQWAPVYTQHSMTTLAIR 75 R++K VL +SG++ + T+H+ T+ A R Sbjct: 268 RWIKMVLAESGVDTSIYTAHSTRHAATSAAAR 299 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 544 FLTFYIFYC 518 FL FY+FYC Sbjct: 14 FLLFYLFYC 22 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 544 FLTFYIFYC 518 FL FY+FYC Sbjct: 14 FLLFYLFYC 22 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 731 LFANYPSWRKGGXCCKAIKLGNARVFPVH 645 +FA+Y ++ G CK + G + FPV+ Sbjct: 385 IFASYFAYIFGKFACKIMIQGFSYAFPVN 413 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 731 LFANYPSWRKGGXCCKAIKLGNARVFPVH 645 +FA+Y ++ G CK + G + FPV+ Sbjct: 385 IFASYFAYIFGKFACKIMIQGFSYAFPVN 413 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 731 LFANYPSWRKGGXCCKAIKLGNARVFPVH 645 +FA+Y ++ G CK + G + FPV+ Sbjct: 385 IFASYFAYIFGKFACKIMIQGFSYAFPVN 413 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 731 LFANYPSWRKGGXCCKAIKLGNARVFPVH 645 +FA+Y ++ G CK + G + FPV+ Sbjct: 385 IFASYFAYIFGKFACKIMIQGFSYAFPVN 413 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 269 ISKALIAFYQKYVDEASKKEIKDI 340 I K +IAFY K + + EIK I Sbjct: 126 IVKPIIAFYYKPIKTLNGHEIKFI 149 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -3 Query: 110 YTQHSMTTLAIRNCGGGXLTSE 45 YTQ+S+ A G G L+ + Sbjct: 1069 YTQYSVVVQAFNKVGAGPLSDD 1090 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 50 SEYLDGLDGLTSCLLH 3 S Y+DG+ +T C +H Sbjct: 143 SPYMDGVPFVTQCPIH 158 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 22 SPSRPSKYSDVRXPPP 69 SP P + DV+ PPP Sbjct: 723 SPLTPHEAFDVKLPPP 738 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 22 SPSRPSKYSDVRXPPP 69 SP P + DV+ PPP Sbjct: 615 SPLTPHEAFDVKLPPP 630 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,850 Number of Sequences: 336 Number of extensions: 4071 Number of successful extensions: 15 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -