BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30398.Seq (865 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) 119 4e-27 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 9e-09 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 5e-08 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 5e-08 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 53 3e-07 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 53 3e-07 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 53 3e-07 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 53 3e-07 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 53 3e-07 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 53 3e-07 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 53 3e-07 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 53 3e-07 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 53 3e-07 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 53 3e-07 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 53 3e-07 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 53 3e-07 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 53 3e-07 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 53 3e-07 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 53 3e-07 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 53 3e-07 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 53 3e-07 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 53 3e-07 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 53 3e-07 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 53 3e-07 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 53 3e-07 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 53 3e-07 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 53 3e-07 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 53 3e-07 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 53 3e-07 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 53 3e-07 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 53 3e-07 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 53 3e-07 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 53 3e-07 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 53 3e-07 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 53 3e-07 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 53 3e-07 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 53 3e-07 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 53 3e-07 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 53 3e-07 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 53 3e-07 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 53 3e-07 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 53 3e-07 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 53 3e-07 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 53 3e-07 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 53 3e-07 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 53 3e-07 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 53 3e-07 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 53 3e-07 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 53 3e-07 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 53 3e-07 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 53 3e-07 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 53 3e-07 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 53 3e-07 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 53 3e-07 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 53 3e-07 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 53 3e-07 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 53 3e-07 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 53 3e-07 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 53 3e-07 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 53 3e-07 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 53 3e-07 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 53 3e-07 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 53 3e-07 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 53 3e-07 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 53 3e-07 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 53 3e-07 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 53 3e-07 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 53 3e-07 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 53 3e-07 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 53 3e-07 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 53 3e-07 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 53 3e-07 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 53 3e-07 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 53 3e-07 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 53 3e-07 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25610| Best HMM Match : MAT_Alpha1 (HMM E-Value=7.2) 53 3e-07 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 53 3e-07 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25265| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 53 3e-07 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 53 3e-07 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 >SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 119 bits (286), Expect = 4e-27 Identities = 55/63 (87%), Positives = 60/63 (95%) Frame = +2 Query: 257 IRQAISKALIAFYQKYVDEASKKEIKDILVQYDRSLLVADPRRCEPKKFGGPGARARYQK 436 IRQAISK+L+A+YQKYVDE SKKEI+DILVQYDRSLLVADPRR E KKFGGPGAR+RYQK Sbjct: 45 IRQAISKSLVAYYQKYVDEVSKKEIRDILVQYDRSLLVADPRRTEAKKFGGPGARSRYQK 104 Query: 437 SYR 445 SYR Sbjct: 105 SYR 107 Score = 52.0 bits (119), Expect(2) = 3e-07 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 156 KLQEPILLLGKEKFSMVXIRVTVKGGGHVAQVY 254 K++EPILLLGKE+F V IRV VKGGGH +++Y Sbjct: 11 KVEEPILLLGKERFEGVDIRVRVKGGGHTSRIY 43 Score = 20.6 bits (41), Expect(2) = 3e-07 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +3 Query: 30 QAVQVFGRK 56 Q+VQVFGRK Sbjct: 3 QSVQVFGRK 11 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 60.1 bits (139), Expect = 2e-09 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = +3 Query: 633 FTNVVNWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 F NVV+WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 11 FYNVVHWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 57 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 58.0 bits (134), Expect = 9e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +3 Query: 624 GRRFTNVVNWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 GRRFT +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 41 GRRFTRR-DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 89 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 57.2 bits (132), Expect = 2e-08 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ G SEK RTD P ++ LNG Sbjct: 139 DWENPGVTQLNRLAAHPPFASWG-NSEKARTDRPSQQLRSLNG 180 >SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 56.0 bits (129), Expect = 4e-08 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ G +EK RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFASWG-NNEKARTDRPSQQLRSLNG 78 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 55.6 bits (128), Expect = 5e-08 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ G SE+ RTD P ++ LNG Sbjct: 75 DWENPGVTQLNRLAAHPPFASWG-NSEEARTDRPSQQLRSLNG 116 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 55.6 bits (128), Expect = 5e-08 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ G SE+ RTD P ++ LNG Sbjct: 60 DWENPGVTQLNRLAAHPPFTSWG-NSEEARTDRPSQQLRSLNG 101 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 54.4 bits (125), Expect = 1e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SEK RTD P ++ LNG Sbjct: 131 DWENPGVTQLNRLAAHPPFA-SWRNSEKARTDRPSQQLRSLNG 172 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 54.4 bits (125), Expect = 1e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SEK RTD P ++ LNG Sbjct: 66 DWENPGVTQLNRLAAHPPFA-SWRNSEKARTDRPSQQLRSLNG 107 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 54.0 bits (124), Expect = 2e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P +V LNG Sbjct: 16 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQVRSLNG 57 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 228 DWENPGVTQLNRLAAHPPFA-SWRTSEEARTDRPSQQLRSLNG 269 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = +3 Query: 624 GRRFTNVVNWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 GRR +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 16 GRRLQRR-DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 64 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +3 Query: 645 VNWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 ++WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 72 LDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 114 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + +EK RTD P ++ LNG Sbjct: 57 DWENPGVTQLNRLAAHPPFA-SWRNNEKARTDRPSQQLRSLNG 98 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = +3 Query: 624 GRRFTNVVNWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 GRR +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 36 GRRLQRR-DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 84 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = +3 Query: 624 GRRFTNVVNWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 GRR +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 26 GRRLQRR-DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 74 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = +3 Query: 624 GRRFTNVVNWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 GRR +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 46 GRRLQRR-DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 94 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + +EK RTD P ++ LNG Sbjct: 55 DWENPGVTQLNRLAAHPPFA-SWRNNEKARTDRPSQQLRSLNG 96 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 73 DWENPGVTQLNRLAAHPPFA-SWSNSEEARTDRPSQQLRSLNG 114 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +3 Query: 645 VNWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 ++WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 72 LDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 114 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = +3 Query: 624 GRRFTNVVNWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 GRR +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 73 GRRLQRR-DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 121 >SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 46 DWENPGVTQLNRLAAHPPFA-SWSNSEEARTDRPSQQLRSLNG 87 >SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 19 DWENPGVTQLNRLAAHPPFA-SWRSSEEARTDRPSQQLRSLNG 60 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 73 DWENPGVTQLNRLAAHPPFA-SWSNSEEARTDRPSQQLRSLNG 114 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 43 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 84 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 70 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 111 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 52 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 93 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 44 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 85 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 70 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 111 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 75 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 116 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 46 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 87 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 66 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 107 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 78 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 119 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 54 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 95 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 43 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 84 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 33 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 74 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 58 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 99 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 67 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 108 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 61 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 102 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 77 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 118 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 65 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 106 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 48 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 89 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 224 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 265 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 119 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 160 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 57 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 98 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 36 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 77 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 24 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 65 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 55 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 96 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 389 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 430 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 115 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 156 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 91 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 132 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 47 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 88 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 16 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 57 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 26 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 67 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 46 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 87 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 111 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 152 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 53 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 94 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 348 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 389 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 88 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 129 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 58 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 99 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 24 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 65 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 67 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 108 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 51 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 92 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 142 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 183 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 71 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 112 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 47 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 88 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 151 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 192 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 841 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 882 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 24 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 65 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 68 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 109 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 42 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 83 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 81 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 122 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 64 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 105 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 77 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 118 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 264 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 305 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 122 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 163 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 58 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 99 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 44 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 85 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 45 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 86 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 109 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 150 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 122 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 163 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 47 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 88 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 28 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 69 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 66 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 107 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 45 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 86 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 42 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 83 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 19 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 60 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 27 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 68 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 404 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 445 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 53 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 94 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 62 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 103 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 44 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 85 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 127 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 168 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 63 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 104 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 73 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 114 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 76 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 117 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 422 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 463 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 119 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 160 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 75 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 116 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 64 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 105 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 54 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 95 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 169 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 210 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 73 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 114 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 60 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 101 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 96 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 137 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 45 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 86 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 71 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 112 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 50 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 91 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 193 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 234 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 42 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 83 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 48 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 89 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 62 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 103 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 59 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 100 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 42 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 83 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 43 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 84 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 57 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 98 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 47 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 88 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 140 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 181 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 49 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 90 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 92 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 133 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 30 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 71 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 161 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 202 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 348 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 389 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 65 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 106 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 29 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 70 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 55 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 96 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 117 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 158 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 94 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 135 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 44 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 85 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 68 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 109 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 302 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 343 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 65 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 106 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 66 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 107 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 24 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 65 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 44 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 85 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 419 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 460 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 103 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 144 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 59 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 100 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 51 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 92 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 101 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 142 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 51 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 92 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 219 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 260 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 51 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 92 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 221 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 262 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 41 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 82 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 56 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 97 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 46 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 87 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 51 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 92 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 155 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 196 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 53 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 94 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 43 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 84 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 63 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 104 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 48 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 89 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 83 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 124 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 203 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 244 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 61 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 102 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 40 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 81 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 94 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 135 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 30 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 71 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 57 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 98 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 195 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 236 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 65 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 106 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 75 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 116 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 58 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 99 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 65 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 106 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 108 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 149 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 84 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 125 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 104 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 145 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 81 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 122 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 48 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 89 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 57 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 98 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 671 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 712 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 56 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 97 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 45 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 86 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 36 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 77 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 154 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 195 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 46 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 87 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 67 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 108 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 96 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 137 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 44 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 85 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 108 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 149 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 51 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 92 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 1198 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 1239 Score = 34.7 bits (76), Expect = 0.098 Identities = 19/35 (54%), Positives = 22/35 (62%) Frame = -1 Query: 775 PFRGATFGXGQSVRXFSLITPVGEKGGXAARRLSW 671 PFR G+SVR SL+ + KGG AARRLSW Sbjct: 406 PFRLRNCWEGRSVRASSLLRQLA-KGGCAARRLSW 439 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 50 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 91 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 40 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 81 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 133 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 174 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 64 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 105 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 85 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 126 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 58 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 99 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 134 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 175 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 176 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 217 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 39 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 80 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 88 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 129 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 38 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRTLNG 79 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 53 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 94 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 24 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 65 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 83 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 124 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 933 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 974 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 42 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 83 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 44 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 85 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 54 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 95 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 44 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 85 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 104 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 145 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 361 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 402 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 91 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 132 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 73 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 114 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 83 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 124 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) Length = 227 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 16 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 57 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 69 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 110 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 92 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 133 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 37 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 78 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 648 NWENPGVTQLNRLAAXPPFSPTGVISEKXRTDWPFPKVAPLNG 776 +WENPGVTQLNRLAA PPF+ + SE+ RTD P ++ LNG Sbjct: 48 DWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNG 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,809,434 Number of Sequences: 59808 Number of extensions: 539181 Number of successful extensions: 7750 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5156 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2467263854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -